(data stored in ACNUC7421 zone)

EMBL: CP002160.PE334

CP002160.PE334       Location/Qualifiers
FT   CDS_pept        438172..438582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50125"
FT                   /db_xref="GOA:D9SQ58"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ58"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3417"
FT                   /protein_id="ADL50125.1"
FT                   /translation="MHFHTNSKESIPSDNIYRNETYENIFKLIEKKNHRIRRVGLGTLS
FT                   FFLIAFAIAFIISVQGKPSIGDNIFIKLGIKTWSRVNWGFHYPVLVSLFFSYLALYLSE
FT                   KYYYQIGGKLARMLSRVYSILLTSIIMVYIYI"
     atgcattttc atactaattc gaaagaatct atacctagtg acaacattta tagaaatgaa        60
     acctacgaaa atatatttaa actaatagaa aagaaaaacc ataggattag aagagttggg       120
     ttaggtactc tttcattctt tctaattgct tttgcaatag catttattat cagcgtacag       180
     gggaagccat ctataggtga taatattttt attaagttag gaataaaaac ttggtcacga       240
     gttaattggg gatttcatta tcctgtatta gtttcacttt tttttagtta tctagcctta       300
     tatttaagtg agaaatatta ttatcagatt ggaggtaaat tagcaagaat gctttcaaga       360
     gtatattcta ttttactaac gtctattatt atggtatata tctatatata g                411
//

If you have problems or comments...

PBIL Back to PBIL home page