(data stored in ACNUC7421 zone)

EMBL: CP002160.PE335

CP002160.PE335       Location/Qualifiers
FT   CDS_pept        438617..438973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0346"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: ckr:CKR_3318 hypothetical protein; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50126"
FT                   /db_xref="GOA:D9SQ59"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ59"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL50126.1"
FT                   /translation="MDENFQCQCNEVHSECVECVKSTMLEEKKFINLSELFKMFADPTR
FT                   LKIIYALLKKELCVCDIAEVIEMSQSSVSHQLRVLKALKLVKYRKEGKVVYYSLDDEHV
FT                   NNIFNFGLSHIEHQ"
     atggatgaaa attttcaatg ccagtgtaat gaagtgcatt ctgagtgtgt agaatgtgta        60
     aagtctacta tgttagaaga aaaaaagttt attaatctct cagaattgtt taaaatgttc       120
     gctgacccta ctaggcttaa aataatatat gctcttttaa aaaaagaact ttgtgtttgt       180
     gatattgcag aggttataga gatgagtcag tcatcagtgt cgcatcaact aagagtttta       240
     aaagccttaa aacttgtaaa gtatagaaaa gaaggcaaag tagtgtatta ttctctagat       300
     gatgagcatg ttaataatat cttcaatttt gggttaagtc atatagagca ccaataa          357
//

If you have problems or comments...

PBIL Back to PBIL home page