(data stored in ACNUC7421 zone)

EMBL: CP002160.PE336

CP002160.PE336       Location/Qualifiers
FT   CDS_pept        complement(439147..439785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0347"
FT                   /product="zinc-dependent hydrolase"
FT                   /note="KEGG: cac:CAC0482 zinc-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50127"
FT                   /db_xref="GOA:D9SQ60"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ60"
FT                   /inference="similar to AA sequence:KEGG:CAC0482"
FT                   /protein_id="ADL50127.1"
FT                   /translation="MKIYFLGESSFILESNNHSRILIDPYNDFYHKELYNLPFDVVTIS
FT                   HHHPNHSYLKNLINKPLVIDTADYHATKDFLIKGIISYHDNVKGARRGKNIIFTYESDG
FT                   YRLCHLGDLGHELSLEFLDFIGDVDVLMIPTGGNFTIGPTEAHNLCIALKPKVIFPMAY
FT                   KTDSISYPLEGLDPFISKMKNGEKLLTNYFEITSPLTSLNRVIILNYSV"
     atgaaaatat actttctcgg tgaatcatca tttattttgg aaagcaataa ccattcacgt        60
     atactcatag atccatataa tgatttctat cataaagaac tttataactt gccctttgac       120
     gttgtgacaa taagtcatca ccatcctaat cattcctatc taaaaaactt gattaacaaa       180
     ccattagtca tagatactgc tgattatcat gcaacaaaag attttttgat aaaaggaata       240
     atttcatacc atgataatgt aaaaggtgct agacgtggta agaatataat tttcacctac       300
     gaatcagacg gttatcgttt atgtcattta ggtgatctgg gtcatgaact ttctttagaa       360
     tttctagatt ttatcggtga tgttgatgtt cttatgatcc ctactggcgg aaacttcact       420
     atagggccca cagaagcaca taacttatgt atagctttaa agccaaaggt catatttcct       480
     atggcatata aaacagattc tatttcctac ccactagaag gtttagatcc ttttatctct       540
     aaaatgaaaa atggcgaaaa acttttaact aattactttg aaataacttc accgctaact       600
     tcgcttaaca gggttattat tttaaattat tctgtataa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page