(data stored in ACNUC7421 zone)

EMBL: CP002160.PE337

CP002160.PE337       Location/Qualifiers
FT   CDS_pept        439894..440961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0348"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: cbt:CLH_3143
FT                   CAAX amino protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50128"
FT                   /db_xref="GOA:D9SQ61"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ61"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADL50128.1"
FT                   /translation="MYKARKGNLLMLIIAVMGILGSLLIAVVGKLAPQILSFLRSDIGT
FT                   IVLLGITDFVFLGVPIGAYILFKRRPLKEIFRFNKLSVIDAMLVAASAILFLPTVSILG
FT                   TITSIFSNNDVGEMVTSISSMPTLVMLFSVAVLPAIFEELALRGIALSEYRNKSIVTAV
FT                   LMNGLLFSLFHLNIQQSLYTFAMGAIMALIVIYTDSIFSSMVFHFVVNGINVIMAKISI
FT                   FILEHTDPSMMDSTNAKVETNAATIISFAFFGIIAMSFLVGGILVVILIRNRNRDKWVG
FT                   KYPPFRMKPANKWFKKDADLDKKSLNSTDEQSDKEYRRVFRRQKRAQRIVDVTLILNIV
FT                   IYIAYTLIMTEQITL"
     ttgtataaag caagaaaagg aaatttattg atgttaataa tagctgtaat gggtatatta        60
     ggatcacttt taatagcagt tgttggaaag ttagctccac aaatcttaag ttttttaaga       120
     agtgatatcg gtactatagt acttttaggg attacagatt ttgtgttttt aggagttcct       180
     ataggggcat atatcctttt taaaagaaga ccattaaagg aaattttcag atttaataag       240
     ctaagtgtta tagatgctat gttagttgct gcttcagcaa tactcttctt acctacagtt       300
     tctattttag gaactataac ttcgatattt tctaataatg atgtaggtga gatggttaca       360
     agtatatctt caatgccaac cttagtgatg ttattttctg ttgctgtatt accagcaatt       420
     tttgaagaat tagcattaag aggaatagct ttatcagaat atagaaataa atcaatagtt       480
     actgcagtac taatgaatgg attattattt tcactatttc atttaaatat acaacaatca       540
     ttatatacct ttgctatggg tgcgattatg gcattgatcg taatatatac tgattcaatt       600
     ttttcatcta tggtatttca ctttgttgtt aatggaataa atgttattat ggcaaagata       660
     agtatattta ttttagaaca tacagatcct tctatgatgg acagtacaaa tgcaaaggtg       720
     gaaactaatg ctgcaacgat aatatcattt gctttctttg gaataatagc catgtctttt       780
     ctagtaggag gaatacttgt tgtaattctt ataagaaata ggaatagaga taaatgggtt       840
     ggaaaatatc caccttttag aatgaaacca gctaacaagt ggttcaagaa agatgctgat       900
     ttggataaaa agtctttgaa tagtactgat gagcaatcag ataaggaata tagaagagtc       960
     tttagaagac aaaagagagc tcaaaggata gtggatgtta cgctaatttt aaatatagtt      1020
     atttacatag catatacctt gattatgact gagcagataa cattataa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page