(data stored in ACNUC7421 zone)

EMBL: CP002160.PE338

CP002160.PE338       Location/Qualifiers
FT   CDS_pept        441605..444712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0349"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="KEGG: cpe:CPE2541 isoleucyl-tRNA synthetase;
FT                   TIGRFAM: isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50129"
FT                   /db_xref="GOA:D9SQ62"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ62"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ADL50129.1"
FT                   /translation="MYKRVDSSKSFVDIERDMAQLWEEKNIIKKSFAANEDGEYFTFYD
FT                   GPPTANGKPHVGHVLTRSIKDLIPRYKVMKGYKVIRKAGWDTHGLPVELEIEKKLGISG
FT                   KSDIEKHGVEDFVKLCKESVFTYVKMWEEMSTKIGYWVDMENPYVTYHNSYIESVWWAL
FT                   RQMWDKELLYKGHKVMPYCPRCGTSLSSHEVAQGYKDVKDLTAFVKFKVKGEENKYILA
FT                   WTTTPWTLPSNVALAINKTYTYVEVKQNDEIYILAKDLLSILKDEYEVVKEFKGEELLG
FT                   TEYEQLLPFYTPEEKAFFVIHGDFVTLSDGTGIVHIAPAYGEDDNIVAKQNNLPTINLV
FT                   TADGKFLPEVTPFQDKFVKNCDADIVKYLEERNQLLKAEKHVHSYPHCWRCDTPLLYYP
FT                   KASWFIKTSSLRDKLLENNDKINWYPDNIRTGRMGKFLENNIDWALSRDRYWGTPLPIW
FT                   ECECGHRHLIGSIDELKTKGIDVPEDIELHKPYIDKVQITCDKCGSAMTRVAEVIDCWF
FT                   DSGSMPFAQLHYPFENKELFEQNFPAQFISEAVDQTRGWFYTLSAISTLIFDRNAFENC
FT                   IVLGHVLDKKGLKMSKSKGNVVAPNDVLDTVGADATRWHFYTSSAPWLPTRFSKEDVAE
FT                   TQRKFLSTLWNVYSFYVLYADLDNFDATKYESHKSDNVMDKWILSKLNTLIKSVEDHLD
FT                   GYRLTQAALELENFVDELSNWYVRRNRARYWTTELTEDKIGAYTTLYKVLVTLSKISAP
FT                   FVPFMTEQIYQSLVVSLDSNAVESVHLCIWPEYDATAINPELEREMDLAYTIVKLGRSA
FT                   RNSANIKNRQPLSEMLVSTKSLPNYYGDIVKEELNIKQIEFGADLSKYVSFEIKPNLPI
FT                   LGKAYGKLIPEIRKEIAARNQMDLAQTISAGKAVTITVGGTDLELNKENLLVTMQGLEG
FT                   FAFAGEGDTGVVLETTITEELREEGFVREILSKIQTMRKESGFEVADKINLYVANNSML
FT                   EEIVKKFASDIMKETLTVNIFYGEAREYVNNKINGEELNIAVEVVK"
     atgtacaaga gagtcgatag ttcaaagagc tttgtggata tcgaaagaga tatggctcag        60
     ctttgggaag aaaaaaatat cataaaaaag agcttcgctg caaatgagga tggagaatat       120
     tttactttct atgatggtcc tccaacagct aatggtaagc cacatgtagg tcacgtatta       180
     actagatcta ttaaggattt aattcctaga tataaagtta tgaagggata taaagtaata       240
     agaaaagcag gttgggacac tcatggactt cctgttgaac tagaaatcga gaaaaaactt       300
     ggtatttcag gaaaatcaga tatagaaaag catggcgtag aagattttgt taagctatgt       360
     aaggaaagtg tttttacata cgttaaaatg tgggaagaaa tgtctactaa aataggttac       420
     tgggttgata tggaaaaccc atatgtaact taccataata gttatataga atctgtttgg       480
     tgggcactaa gacagatgtg ggataaagaa ttattatata aaggacacaa ggtaatgcct       540
     tactgtccaa gatgtggaac ttcattatct tctcacgaag ttgcacaagg ttataaagat       600
     gttaaggatt taactgcttt cgttaagttt aaggttaaag gggaagaaaa caaatacatt       660
     ttagcttgga ctactactcc ttggacttta ccatcaaacg tagctttagc aattaacaaa       720
     acttatacat atgttgaagt aaaacaaaat gatgaaatat atattttagc aaaagatctt       780
     ttatcaatat taaaagatga atacgaagta gttaaagaat ttaaaggtga agaattatta       840
     ggtactgagt atgaacaact tttaccattc tatacaccag aagaaaaagc attctttgta       900
     attcatgggg atttcgtaac gttaagtgac ggtactggaa tagttcatat tgcacctgct       960
     tatggtgagg atgataatat agttgcaaag caaaataatc ttccaactat aaatcttgtt      1020
     actgctgatg gaaagttcct tccagaagta acaccatttc aagataaatt cgttaagaac      1080
     tgtgatgcag atatagttaa atatttagaa gagagaaatc aacttctaaa agctgaaaag      1140
     catgttcact catatcctca ttgctggaga tgtgatacac cacttttata ctatccaaag      1200
     gctagttggt ttataaagac tagttcatta agagataaac ttcttgagaa caacgataaa      1260
     atcaattggt atccagataa cataagaaca ggaagaatgg gtaaattcct tgaaaacaat      1320
     attgactggg ctctttcaag agatagatat tggggaacac cactcccaat ttgggaatgt      1380
     gaatgtggcc acagacatct tatcggtagc atagatgaat taaaaacaaa aggaatagat      1440
     gtaccagaag atatcgagct tcataagccg tatatagata aggttcaaat aacttgtgat      1500
     aagtgtggca gtgctatgac aagagtagca gaggttatag attgttggtt tgactcaggt      1560
     tcaatgccgt ttgcacaatt acactatcca tttgaaaaca aagaattatt tgaacaaaac      1620
     ttcccagctc agtttatttc tgaagcagtg gatcaaacaa gaggatggtt ctatacatta      1680
     tctgcaatat caacattgat ttttgacaga aatgcttttg aaaattgtat agttttaggc      1740
     cacgtactag ataaaaaagg tcttaagatg tctaaatcaa aaggaaatgt tgttgcacct      1800
     aatgatgtat tagatacagt aggagcagat gctacaagat ggcatttcta tacttcaagt      1860
     gcaccatggc ttccaactag attctcaaaa gaagacgttg cagaaactca aagaaagttc      1920
     ctaagtactt tatggaatgt atattccttc tatgtgttat atgcagattt agataatttt      1980
     gatgctacta agtacgaaag ccataaatca gataatgtta tggataagtg gattctttca      2040
     aaattaaata ctctaatcaa gagtgtagaa gatcacttag atggctacag attaactcaa      2100
     gctgctttag aacttgaaaa ctttgttgat gagctttcaa actggtatgt aagaagaaac      2160
     agagcaagat actggactac tgaacttaca gaggataaga taggtgccta tacaacttta      2220
     tataaagttc tagtaacttt atcaaagata tcagctccat ttgttccatt tatgacagaa      2280
     caaatctatc aaagcttagt agtatcttta gacagtaatg cagtagaaag tgttcactta      2340
     tgtatatggc cagaatatga tgcaactgct ataaatccag aattagaaag agaaatggat      2400
     ttagcttata caatagttaa gttaggaaga agtgcaagaa atagtgctaa cataaagaac      2460
     agacagccat tatcggaaat gcttgtttca actaagtctc ttccaaacta ttatggtgat      2520
     atagttaaag aagaacttaa cataaagcaa atagaatttg gagctgattt atcaaaatat      2580
     gtttcctttg aaataaaacc taacttacct atacttggta aagcatatgg taagttaata      2640
     ccagaaatca gaaaagaaat cgcagctaga aaccaaatgg atcttgctca aactatcagt      2700
     gcaggtaaag cagttacaat aactgttggt ggcacagatc ttgaattaaa caaggaaaat      2760
     cttcttgtaa caatgcaagg gctagaagga tttgctttcg ctggagaagg ggatactggt      2820
     gtagttttag aaacaacaat aacagaagaa cttcgtgaag aaggattcgt aagagaaata      2880
     ttatcaaaaa tccaaactat gagaaaagaa agcggttttg aagttgcaga taagattaac      2940
     ctttatgtag caaacaactc aatgcttgaa gaaatagtga agaaatttgc tagtgatatt      3000
     atgaaggaaa ctctaacagt taacatattc tacggagaag ctagagagta tgtaaacaac      3060
     aaaataaatg gtgaagaatt aaatatcgct gttgaggttg taaaataa                   3108
//

If you have problems or comments...

PBIL Back to PBIL home page