(data stored in ACNUC7421 zone)

EMBL: CP002160.PE340

CP002160.PE340       Location/Qualifiers
FT   CDS_pept        447113..448045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0351"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cac:CAC2324 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50131"
FT                   /db_xref="GOA:D9SQ64"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ64"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADL50131.1"
FT                   /translation="MEIAVLIPCYNEEITIGKVVEDFKRELPQAKIYVYDNNSKDRTSE
FT                   IAAAKGAIVVKETRQGKGNVVRSMFRDIEADVYIMVDGDDTYPAEFVHKLIKPVMDDEA
FT                   DMVIGDRLSNGTYKSENKRPFHNFGNKLVKSLIGWTFKNEINDIMTGYRAFNRFFVKTM
FT                   PVLSSGFEIETEMSIHSLDKRFRLTEIPIDYRDRPEGSDSKLNTYRDGYRVIKVIFSLF
FT                   KDYKPLAFFSILSILFLLLGIIIGTPVIVEFIESSYITKLPSAVLAVGLVIIAILSMAC
FT                   GLILDTISKNSKKQYELQLNDYKKEGIQL"
     atggaaattg cagtgcttat accatgttat aatgaagaaa ttactattgg gaaagtcgta        60
     gaggatttta aaagagaatt accacaggct aaaatatatg tttatgataa caactcaaag       120
     gatagaactt cagagattgc cgcagcaaag ggtgctatag tagtaaaaga aacacgacaa       180
     ggcaaaggta atgttgttag aagcatgttt agggatatag aggcagatgt atatattatg       240
     gtagatgggg atgatactta tcctgcagaa tttgtacata agcttataaa acctgttatg       300
     gatgatgaag cagatatggt tattggggat agactttcta atggaaccta taaaagcgag       360
     aacaagagac cgttccataa ctttggtaac aaattagtta aaagcttaat aggctggact       420
     tttaaaaatg aaataaatga tattatgaca gggtacagag cttttaatag gttctttgtt       480
     aaaacaatgc cagttttaag ctctggtttc gaaattgaaa cagaaatgag catacattcg       540
     ttggataaga gatttaggtt aacagaaatt cccatagatt atagagatag accagaagga       600
     agtgattcaa agttaaatac ctacagagat ggttatagag ttattaaagt aatattctca       660
     ttatttaaag attataagcc attagcattt ttctcaatat tatctatttt gtttttatta       720
     ctaggtatta ttataggaac tcctgtaata gtggagttta tagaatctag ctatataaca       780
     aaacttcctt cagcagtttt ggcagtagga ttagttataa ttgctatttt atctatggct       840
     tgcggattaa ttctagatac aatatcaaag aacagcaaaa agcaatatga gctacaattg       900
     aatgattata aaaaagaagg aatacaactg taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page