(data stored in ACNUC7421 zone)

EMBL: CP002160.PE344

CP002160.PE344       Location/Qualifiers
FT   CDS_pept        complement(450065..450313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hiq:CGSHiGG_03090 putative type I
FT                   site-specific restriction-modification system, R subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50135"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ68"
FT                   /inference="similar to AA sequence:KEGG:CGSHiGG_03090"
FT                   /protein_id="ADL50135.1"
FT                   /translation="MLDKIKIGIYKNRLGKKVESLLGFDSKTSSEIVQQAYDLYKKTVD
FT                   TYAKNNNLSHDESKKKIFELLQEDKDIKDFLEKQKSS"
     atgctagata aaataaagat tgggatatat aaaaataggc taggaaaaaa agttgaaagt        60
     ctcttaggtt ttgactcaaa gacctcttct gagatcgtcc agcaagctta tgatctatat       120
     aaaaagactg tagataccta cgctaaaaat aataatcttt ctcacgatga atcaaagaaa       180
     aaaatttttg aactacttca ggaagataaa gacataaaag attttctaga aaaacaaaaa       240
     tcaagttaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page