(data stored in ACNUC7421 zone)

EMBL: CP002160.PE346

CP002160.PE346       Location/Qualifiers
FT   CDS_pept        455002..455697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0357"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   cbo:CBO0392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50137"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ70"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ADL50137.1"
FT                   /translation="MKTIKLDSKVFTYEIKRSKRKTIALRVVSKGTIKISAPLMISVKT
FT                   IEDIIREKTSWILDNAKKQEEIEARFRNRNKILFLGKEYCIEREINKDKTFDFKIDGEI
FT                   FKIIFPRVLEEQEEKELLMRWMKNESRKILKARTDFYCKLLELSYNEIHIKDQKTLWGS
FT                   CSSKDNINYNYRIIMAPIEIVDYLVVHEACHLVHRDHGKAYWNLVGSVIPDYKERRAWL
FT                   KNNGLLLKI"
     gtgaagacta taaaattaga tagcaaagtt tttacctatg aaataaaaag aagcaaaaga        60
     aaaactatag ctttgagagt agtgtcaaag ggtaccataa aaatatcagc accgttaatg       120
     atatccgtta agactattga agatattatc agggagaaaa cttcatggat actggataat       180
     gcaaaaaaac aggaagaaat agaggcaaga tttagaaatc ggaataaaat tcttttttta       240
     ggaaaagaat actgtataga aagagaaata aataaggaca aaacttttga ctttaaaata       300
     gatggtgaaa tctttaaaat tatatttcca agagtgttag aggaacaaga agaaaaagaa       360
     ttgttaatga gatggatgaa gaatgaatct cgtaaaatct taaaggcaag aactgatttt       420
     tattgtaagt tactagaact tagttacaat gaaattcata taaaagacca gaaaactctt       480
     tggggaagct gttctagtaa ggataacatt aattataact ataggattat aatggcaccg       540
     atagaaatcg tagattattt agtcgttcat gaagcatgtc atttggtaca tagagatcat       600
     ggtaaagcgt attggaattt ggttggcagt gttatacctg attataagga aagaagagct       660
     tggcttaaga ataatggatt gctacttaaa atataa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page