(data stored in ACNUC7421 zone)

EMBL: CP002160.PE347

CP002160.PE347       Location/Qualifiers
FT   CDS_pept        456055..458031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0358"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; UvrB/UvrC protein; type III restriction
FT                   protein res subunit; KEGG: cno:NT01CX_1274 excinuclease ABC
FT                   subunit B; SMART: DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50138"
FT                   /db_xref="GOA:D9SQ71"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ71"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ADL50138.1"
FT                   /translation="MEEFKIVSEYKPTGDQPQAIESISERVLAGDKFQTLLGVTGSGKT
FT                   FTMANIIEKVQKPTLVLAHNKTLAAQLCSEFREFFPDAAVEYFVSYYDYYQPEAYVAQT
FT                   DTFIEKDASINDEIDRLRHSATAALFERKDVIIVASVSCIYGLGNPDEYRKLSLSLRKG
FT                   MEKDRDEIMRKLIDMQYERNDINFVRATFRVRGDILDIFPASSQKVGIKVEFFGEEIDR
FT                   IREFDVLTGQILRELKHVLIFPASHFASSKETVERSIGKIEAELDERVKELLAEEKLLE
FT                   AQRLKQRTNFDIEMIREMGYCQGIENYSRIMDGRNKGEPPKTLIDFFPEDFLMFIDESH
FT                   VTLPQVRAMYGGDRSRKEALVNYGFRLPCAYDNRPLKFEEFEEKLKQVVFVSATPAKYE
FT                   FDHSTNVAEQIIRPTGLLDPIIEVRPIDGQIDDLYSSIQETIVRGFRILVTTLTKKMAE
FT                   DLTDYLKEMGVKTNYLHSDVTTIDRMKIIKELRMGDFDVLVGINLLREGLDIPEVALVA
FT                   ILDADKEGFLRSNTSLIQTVGRAARNADSKVIMYADKITDSMSYTIKETERRRKIQIDY
FT                   NEAHNITPTTIIKGIRDNIQISTIAEEEAVYLTEETMSQEDLKKKIASLEKEMKAVAKE
FT                   LQFERAAELRDEINKLKTIMNND"
     atggaagagt ttaaaatagt atcagaatac aaacccactg gagatcagcc ccaagctata        60
     gaaagcattt cagagagagt gcttgcaggt gataaatttc aaactctcct tggtgtaact       120
     ggttctggta agaccttcac catggcaaac ataatagaaa aagttcaaaa gccaacatta       180
     gttcttgcac ataacaagac tttagctgca cagttatgtt cagagtttag agaatttttt       240
     cctgatgcag cagttgaata ctttgtatct tattatgatt attaccagcc agaagcttat       300
     gttgcacaaa cagatacatt tatagaaaaa gatgcttcta taaatgacga aattgataga       360
     ttaaggcatt cagctactgc agcacttttc gaaagaaagg atgttataat agtagcttct       420
     gtttcttgca tctatggact gggtaatcca gacgaatata gaaaactttc cttgtcctta       480
     agaaagggaa tggaaaaaga cagagatgag ataatgagaa agctcatcga tatgcaatat       540
     gaaagaaatg atattaactt tgtgagagcc acatttagag taagagggga tatcttagat       600
     attttcccag cttcatctca aaaagttgga atcaaggtag agttttttgg agaagaaata       660
     gatagaataa gggaatttga tgttttgaca gggcagatac ttagagagtt aaagcatgtg       720
     cttattttcc ctgcatccca ctttgcttct tctaaggaaa ctgtagaaag atctataggg       780
     aaaattgagg cagaattaga tgagagagta aaagagctct tagcagaaga aaagctttta       840
     gaagctcaga gattaaagca aagaaccaac tttgatatag aaatgataag agagatggga       900
     tattgccaag gaattgagaa ctactcaagg attatggatg gcagaaataa aggagaacct       960
     ccaaaaactt taatagattt ctttccagag gattttttga tgttcataga tgaaagtcat      1020
     gtaacacttc cacaggttag agctatgtat ggaggagatc gttctagaaa ggaagctttg      1080
     gttaattatg gtttcaggtt gccttgcgct tatgataaca ggcctcttaa atttgaggaa      1140
     tttgaggaaa aactaaagca agtagttttt gtaagtgcta ctcctgcaaa atatgaattt      1200
     gatcattcaa ctaatgttgc agagcaaata ataagaccta caggactttt agacccaata      1260
     atcgaggtaa gacctattga tggacaaatt gatgacctct attcaagtat acaagaaact      1320
     atagttagag gttttagaat tcttgttact acgctgacaa agaagatggc agaggattta      1380
     actgattacc taaaagaaat gggagttaag acaaattacc tacactcaga tgtaacaact      1440
     atagatagaa tgaaaataat caaagaactt agaatgggtg attttgatgt gctagttgga      1500
     attaaccttt taagagaagg attggatata ccggaagttg cattagtagc aatccttgat      1560
     gctgataaag aaggcttttt aaggtcaaat acttcattaa ttcagactgt aggaagagct      1620
     gctagaaatg ctgatagtaa agttataatg tatgcagata agataaccga ttctatgagt      1680
     tatacgataa aagaaacgga aagaagaaga aagattcaga tagattacaa tgaagcacat      1740
     aatattactc ctactactat cataaagggt ataagggata atattcagat atctacaata      1800
     gctgaagaag aagctgtata tttaacagaa gaaacaatgt cacaagaaga tttgaaaaag      1860
     aagatagcaa gtttagaaaa agaaatgaag gctgtagcaa aagaacttca attcgaaaga      1920
     gcagctgaac ttagagatga aattaataag ttaaagacaa ttatgaataa tgactaa         1977
//

If you have problems or comments...

PBIL Back to PBIL home page