(data stored in ACNUC7421 zone)

EMBL: CP002160.PE351

CP002160.PE351       Location/Qualifiers
FT   CDS_pept        464904..465839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0362"
FT                   /product="NlpA lipoprotein"
FT                   /note="KEGG: cth:Cthe_2802 NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50142"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ75"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2802"
FT                   /protein_id="ADL50142.1"
FT                   /translation="MKNFKRSISLIIITMLVLSIVGCGKEKKSETSVKIGYLPITHAIP
FT                   LYIENEVAKGDIELVKFGSWAELMDALNSGKIDGASVLIELAMKAKAQGVDLKAVALGH
FT                   TDGNAVVVSDEINTAKDIKGKNFAIPNKVSTHNILLYEMLKKENIKINEVNIVELPPSE
FT                   MAVALQEKRIDGYCVAEPFGAKSVVNGNGKVLKQSSEILKNSICCSLVLRGDFIEKNKA
FT                   KASEVVSKYVEASKYIEENEVDTRSKAKEFLSVKEDVLDVSLQWISFKKLKIEEADYNS
FT                   IVGYIKEMNLFDNPPTYEEFIDNSLLEEVK"
     atgaaaaatt ttaaaagaag catatcatta attattatta ctatgttagt tttgtcaatt        60
     gttggatgtg gcaaagagaa gaaatctgaa accagtgtaa agattggata tttgccaata       120
     actcatgcaa tacctttata tattgaaaat gaagttgcaa agggggatat tgaacttgta       180
     aagtttggtt cttgggcaga acttatggat gctcttaatt caggtaaaat tgatggggca       240
     tcagttttaa ttgaacttgc tatgaaggct aaagcacaag gggttgattt aaaagcagta       300
     gcattgggtc atacggatgg taatgcagta gttgtttctg atgaaataaa cactgctaaa       360
     gatataaaag gaaaaaactt tgctattcct aacaaggtat ccacccataa tatcttatta       420
     tatgaaatgc ttaaaaagga aaatatcaaa attaatgaag taaatatagt tgagttacca       480
     ccttcagaaa tggcagtggc gcttcaagaa aaaaggattg acggttattg tgtagctgaa       540
     ccatttggag caaagtctgt tgttaacgga aatggaaaag ttttaaaaca atcttctgaa       600
     atacttaaaa attctatctg ttgttctttg gttttacgag gtgattttat agagaaaaat       660
     aaagcaaagg cttcagaggt tgtaagtaaa tatgtagaag cttcaaaata tattgaagag       720
     aatgaagtag atacaagaag caaggcaaag gaatttttga gtgtaaaaga agatgtatta       780
     gatgtatctc ttcaatggat atcatttaag aaattaaaga tagaagaagc agactataat       840
     tcaattgttg gatacataaa ggaaatgaat ctttttgaca acccacctac ctatgaagag       900
     tttatagata attcgttgtt agaagaggta aagtga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page