(data stored in ACNUC7421 zone)

EMBL: CP002160.PE355

CP002160.PE355       Location/Qualifiers
FT   CDS_pept        complement(469717..470286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0366"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: ckr:CKR_0471 hypothetical protein; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50146"
FT                   /db_xref="GOA:D9SQ79"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ79"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADL50146.1"
FT                   /translation="MNKLQEILDYNHHFVESKEYEKYATSKEPNKKLVILSCMDTRLTE
FT                   LLPKALNLKNGDVKLIKNAGASIMHPFGSIIRSIVVAVYEYNADEVLVIGHHGCGMSNL
FT                   NADKTIEKAKERGVSSEVLSTLSNAGIDVKGWLHGFNSVEESIKESVDLIKNHPLLPKD
FT                   IKVHGLIIDPSTGKLDVVINGYTENN"
     atgaataaat tacaagaaat tttagactac aatcaccact ttgttgagtc aaaagaatac        60
     gaaaaatacg ctacctcaaa agaaccaaat aaaaaactag taatcttatc ttgcatggat       120
     actaggttaa ctgaacttct accaaaagca ttaaatttaa aaaacggtga tgtaaaactt       180
     ataaaaaatg ctggggcatc tataatgcat ccttttggta gtattataag aagcattgtt       240
     gtagctgtat atgaatataa tgcagacgaa gttttagtaa ttggtcatca tggatgtggt       300
     atgagcaact taaatgctga taaaactata gaaaaagcaa aagaaagagg tgtttcttca       360
     gaagttttat ctactttgag caatgcaggc atcgatgtta aaggctggtt gcatggcttt       420
     aactctgttg aagaatctat aaaggaaagt gttgacctaa taaaaaatca tccattacta       480
     cctaaagaca ttaaagtcca cggcttaatt attgatccat caactggtaa acttgatgtt       540
     gttattaatg gttataccga gaataattaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page