(data stored in ACNUC7421 zone)

EMBL: CP002160.PE357

CP002160.PE357       Location/Qualifiers
FT   CDS_pept        472571..473323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0368"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: cpe:CPE1018
FT                   4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50148"
FT                   /db_xref="GOA:D9SQ81"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ81"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADL50148.1"
FT                   /translation="MIIINDKISEQLVFDDGFYFGKALFETILVLEKPVFLKEHLERLN
FT                   KGLELLKINKKITEEYINRVISEKEIKNQVLKITVSVKNIVINTRPITYTDEEYKNGFK
FT                   LCFSEVIRNSTSMLSYVKSVNYIENIIEKEKAMDKGFQEVIFANEHGKICEGSCSNIFF
FT                   IKNKNIYTPKVSCGILTGVVRAWVINNYKVEEGEYDINNLLESDEIFITNSIMGIMKVK
FT                   TLNDRVYDDQITKGIMDYYFKTLDEDYR"
     atgattatta ttaatgataa gataagtgaa cagttagtgt ttgatgatgg gttttatttt        60
     ggaaaagcat tattcgaaac gattttagtt cttgagaaac cagtattttt aaaagagcat       120
     ttagaacgtt taaataaagg tttggaactt cttaaaataa ataagaaaat tacagaagaa       180
     tatataaata gagtaattag tgaaaaggaa ataaaaaatc aagtgcttaa aattacagta       240
     agtgtgaaaa atattgtaat taatacaaga ccgataacct atacagatga agagtataaa       300
     aatggattta agctttgctt ttcggaggta attcgaaact cgacctctat gctctcttat       360
     gtaaagtctg tgaattatat agagaacatt attgagaagg aaaaagctat ggataaaggt       420
     tttcaagaag ttattttcgc taatgaacat gggaaaatct gtgagggttc ctgttctaat       480
     atattcttca ttaaaaacaa gaacatatat actcctaaag ttagttgtgg tattttaaca       540
     ggggttgtta gagcttgggt aattaacaac tacaaagtag aagaaggaga atatgatata       600
     aacaatttac tagagagtga tgagatattt attaccaact caattatggg aataatgaaa       660
     gtaaaaactt taaatgatag agtttatgat gatcagatca caaaaggtat tatggattat       720
     tattttaaaa ctcttgatga agattatagg taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page