(data stored in ACNUC7421 zone)

EMBL: CP002160.PE358

CP002160.PE358       Location/Qualifiers
FT   CDS_pept        473621..474070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0369"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: ckr:CKR_3149 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50149"
FT                   /db_xref="GOA:D9SQ82"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ82"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADL50149.1"
FT                   /translation="MFSELSVIFKVIIIIIIYVIIFFALRIMYKDLKGGGRQNQGPKHT
FT                   PVKRKKYGLEVININPSDNLKIGSVIMISGQIVIGRKDNNDLILSSQYVSGTHARVFLQ
FT                   NDKYLIEDLQSTNGTFLNGERLEGKAQLSIGDTVSIGEAEFKVIG"
     gtgtttagtg aactgagcgt tatatttaag gtcattatca taattataat atatgtaatt        60
     atattttttg cattaagaat aatgtataaa gaccttaagg ggggtggcag acaaaatcaa       120
     ggcccaaaac atacaccagt aaaaagaaaa aaatatgggc ttgaggttat taatataaat       180
     ccaagtgata acctaaaaat aggttccgta attatgatat caggtcaaat tgtaatagga       240
     agaaaagata ataatgatct gatattaagt agccaatatg tttcagggac tcatgctagg       300
     gtgtttttac agaatgataa atatttgata gaagatctac aaagtaccaa tggaactttt       360
     ttaaatggtg aaagattaga aggaaaagcc cagctttcta taggtgatac tgtttctata       420
     ggtgaggctg aatttaaagt aatagggtga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page