(data stored in ACNUC7421 zone)

EMBL: CP002160.PE367

CP002160.PE367       Location/Qualifiers
FT   CDS_pept        483938..484954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0378"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: transcriptional regulator, LacI family; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   regulatory protein LacI; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50158"
FT                   /db_xref="GOA:D9SQ91"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ91"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL50158.1"
FT                   /translation="MAKAPSLKDVAKLAGVGLGTASRVLNNSGPVTDEKRQAVFEAMEK
FT                   LNYKPNAIARSLKSKKTKTIGVMIPDISNPFYPEVIRGIEDVANKYSYSIFLLNTDRSR
FT                   EKEQKCLSVLQEKMVDGAILMSFSVPEEIKNHINNIPIVLISSIPKNTEFVTVRIDNEE
FT                   AAYEAVNHLCKFGHKDIVMISGPLSDENAAIPRVQGYMRAMLDNGIKFSSENIVDGDFS
FT                   SEWGYIAMKKILEREKIPTAVFTHSDNLAIGAIKAIMEKGLRIPEDISIVGFDGIASSE
FT                   YIYPGITTIKQPRYEMGAMGMETLVKLINGVETKKLIKMDVQLVERNSCKNLLTEDK"
     atggctaagg caccaagttt aaaggatgtc gcaaagcttg ctggtgttgg acttggtact        60
     gcatctagag ttttaaataa ctctggtcca gtaactgatg aaaagagaca agctgttttt       120
     gaagccatgg aaaagcttaa ttataagccg aatgcaatag caagaagctt aaaaagcaaa       180
     aaaactaaaa ctattggagt aatgatacca gacatatcaa atccatttta tccagaggta       240
     ataagaggaa tagaagatgt agctaataaa tatagttaca gcatatttct tttaaacaca       300
     gacagatcca gagagaagga gcaaaagtgt ttatctgtgc tccaagagaa gatggtagat       360
     ggagctatcc ttatgagttt ttcagtacca gaagaaatta aaaaccacat aaataatatc       420
     cctatagtgc ttattagttc tattccaaag aatactgagt ttgtaactgt gagaattgat       480
     aatgaggaag ctgcatatga agcggtaaat catttgtgta aatttggaca caaggacata       540
     gttatgattt caggtccatt aagtgacgaa aatgccgcaa ttccaagagt tcaaggatat       600
     atgagagcca tgctagataa tggcataaaa tttagctcag aaaatattgt tgatggtgat       660
     tttagttcag aatggggcta catagctatg aagaaaatat tagaaagaga aaaaattcca       720
     acagcagttt ttactcattc agataatcta gctattggtg ctattaaagc aattatggaa       780
     aagggattaa gaattcctga ggacatttct attgtaggtt ttgacggaat agcaagtagt       840
     gaatatatat atccaggcat tacaactata aaacagccaa gatatgaaat gggagctatg       900
     ggaatggaaa ccttagtgaa gcttataaat ggagttgaaa ctaaaaaact tataaagatg       960
     gatgttcaac tagttgaaag gaattcatgt aagaatttat tgactgaaga taagtaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page