(data stored in ACNUC7421 zone)

EMBL: CP002160.PE371

CP002160.PE371       Location/Qualifiers
FT   CDS_pept        487402..489219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0382"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: cbl:CLK_0937 stage V sporulation protein D;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50162"
FT                   /db_xref="GOA:D9SQ95"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ95"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADL50162.1"
FT                   /translation="MKKKKPFEKNQRLFVAFMTIIFIFIGLMGNYARLLIKHGEEYKTD
FT                   AERRWFSKEEVTAKRGKILDSNGNELGVSGNVFRADLDLKTLREDGEDTDDAKARYDIG
FT                   DVAGDMAKILGMTKEEVMEIINSTDSEGEPQNFAQLKRKIEANQAEALTKLKSEKEVRA
FT                   IIISEDTKRYYPNNEFASKLIGHVNGDDKGLTGVELYYDKYLSGISGQYIQEEDGFSNP
FT                   LPFTKPTYYPPVQGSDIYLSIDNRIQRLAERIAEKGKKDTAAESVYIVVSDPNTGEIVA
FT                   MASTGGYDLNNPWISGKSYEELQASWRNNIVSDSFELGSIFKPILAAAALENKAIANDQ
FT                   IIVDCKGSINVAGSPIACDSGTSHGPETIVDILRNSCNVGCVKVAELLGADKLHQYIEK
FT                   VGLGQATGIDIEGESEGIVLRTDEMGPVELATISYGHANTSTMIQYIAAFNAIANGGTY
FT                   ISPHILKEIKGYNSDGSTFAQKTFDTGRKKAIIAPEVAATVRQDLINVVNHPKGMQIPG
FT                   YQFGGKTGTAMATEKGEYIAGKYISSFASMLPADKPQYTMMVTVKYPKPEAYYASQTAM
FT                   PIAKELWTAMIAELGIKPTMPVTTTPTGN"
     atgaaaaaga aaaaaccttt tgaaaagaat caaagattat ttgtagcatt tatgactata        60
     atatttatat ttataggtct tatgggaaac tatgctaggt tacttataaa acatggagaa       120
     gagtataaga cagatgctga aagaagatgg tttagtaaag aagaggtaac ggcaaaaaga       180
     gggaagatcc ttgattccaa tggaaatgaa cttggtgtaa gtggaaatgt ctttagagca       240
     gatttagatt tgaaaacatt aagagaagat ggtgaagata cagacgatgc taaagcacgt       300
     tatgatattg gggatgttgc aggagatatg gcaaaaatat taggtatgac taaggaagaa       360
     gtcatggaga ttatcaacag tactgattct gaaggagaac ctcaaaattt tgcacagtta       420
     aaaagaaaaa tagaggcaaa tcaagcggag gcactaacaa aattaaaaag tgaaaaagaa       480
     gtaagagcaa taattatctc tgaggataca aaacgatatt atccaaataa cgagtttgca       540
     tctaagctta ttggtcacgt aaatggtgat gacaagggac ttacaggagt tgaactttat       600
     tatgataaat acctttctgg aatttcagga caatatattc aagaagaaga tggattttca       660
     aatccattgc cttttacaaa accaacgtat tatccaccgg ttcaaggaag tgatatatat       720
     ttatctatag acaatagaat tcaaagatta gctgaaagaa ttgcggagaa aggtaaaaaa       780
     gatactgccg ctgaaagtgt atatatagtt gtttcagatc cgaacactgg agaaatagta       840
     gctatggcaa gtactggtgg gtatgatctt aataatccat ggataagtgg caagtcttat       900
     gaagaattgc aagcttcttg gagaaataat attgtcagtg attcctttga actaggatca       960
     atctttaaac ctatcttagc agcagcagct ttagaaaata aagctatagc taatgatcag      1020
     attattgttg attgcaaagg aagcattaac gttgcaggtt caccaatagc ttgtgattca      1080
     ggtacttcgc atggtccaga aactatagta gacatactaa gaaattcatg caacgttggt      1140
     tgtgtaaagg ttgcagaatt gttaggtgct gataagctgc atcaatatat agaaaaggta      1200
     gggcttggac aagctacagg gatagatatt gaaggtgaat cagaaggtat agttttaaga      1260
     actgatgaga tggggcctgt tgaacttgct accatttcat atggccatgc taacacttca      1320
     acaatgattc aatatatagc tgcttttaat gctattgcca atggtggtac atatatatca      1380
     ccacatatat taaaggaaat aaagggatac aattctgatg gaagtacttt tgcacaaaag      1440
     acttttgata ctggacggaa gaaggctatt attgcaccag aggttgctgc aactgtgagg      1500
     caggacctta taaatgtagt taaccatcca aaagggatgc agataccagg atatcagttt      1560
     ggtggaaaga caggaacggc tatggcaact gaaaaaggag aatatatagc agggaaatat      1620
     atttcttcct ttgcttctat gttgccagca gataaacctc aatatactat gatggtaaca      1680
     gtaaaatatc caaaaccaga ggcatattat gcttctcaaa cagcaatgcc aatagcgaag      1740
     gaattatgga cagctatgat agcggaatta gggattaaac ctacgatgcc agtaacaact      1800
     acacctacag gaaattag                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page