(data stored in ACNUC7421 zone)

EMBL: CP002160.PE373

CP002160.PE373       Location/Qualifiers
FT   CDS_pept        489999..490565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:541384 myosin binding protein C, fast type
FT                   b"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50164"
FT                   /db_xref="GOA:D9SQ97"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ97"
FT                   /inference="similar to AA sequence:KEGG:541384"
FT                   /protein_id="ADL50164.1"
FT                   /translation="MDERKKNIVIVSVIGFLILIMMIFFCKFSFDKLMNKSERTKKHNP
FT                   NIVNNAVSDANCIIDWRMSDMVVHQLARAQDENVKAMIREGYKEYFNSNSDLLDVESKI
FT                   IKELPKGFGNRRPQSLVSVPITVEHPTSIDQICDIIKKRPSFSINGAENTAETDATAKY
FT                   HQDFIITNNKEGVYTIYMIFYDSGA"
     atggatgagc gtaaaaaaaa tatagtaata gtaagtgtaa ttggattctt aatattgatt        60
     atgatgattt ttttctgcaa gttttctttt gataaattga tgaataaatc agaaagaact       120
     aagaagcata atcctaatat tgttaataac gcagtgagtg atgcaaattg cataatcgac       180
     tggaggatgt ctgatatggt agttcaccag ttagctagag cgcaagatga aaatgttaaa       240
     gctatgataa gagagggata taaggagtat tttaactcta attcagattt gttagatgtg       300
     gaaagcaaaa taataaaaga actaccaaaa ggttttggaa acagaagacc tcaatctttg       360
     gtttctgttc ctataacggt tgagcatcca acaagtattg atcaaatttg tgatatcatc       420
     aaaaaaaggc cgtcatttag cataaatgga gcagagaaca cggctgaaac agatgccaca       480
     gcaaagtatc atcaagactt tattattact aataataagg aaggggttta tactatatat       540
     atgatttttt atgatagtgg ggcttaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page