(data stored in ACNUC7421 zone)

EMBL: CP002160.PE377

CP002160.PE377       Location/Qualifiers
FT   CDS_pept        496405..497364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0388"
FT                   /product="6-phosphofructokinase"
FT                   /note="KEGG: ctc:CTC02490 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50168"
FT                   /db_xref="GOA:D9SQA1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA1"
FT                   /inference="protein motif:TFAM:TIGR02482"
FT                   /protein_id="ADL50168.1"
FT                   /translation="MKTIGVLTSGGDSPGMNAAIRAVVRTALQNNIRVVGIQRGYSGLI
FT                   NGEITELTRDSVSDIIQRGGTILKTARSNTFRTEEGRRRAADVLKVFGVEGLVVVGGDG
FT                   SFMGAKLLSDLGVATIGLPGTIDNDLAYTDYTIGFDTALNTVIDAVNKLKDTSSSHERA
FT                   SVVEVMGRNCGDIALYSGLAGGAESIILPEKPFDMDELCRGILEGKMRGKLHNLIMVAE
FT                   GVGKAEEIAKKIEDITGIEARVTKLGHIQRGGSPTVADRVLATRMGYRAVELLREGKSA
FT                   RVVGIKNNKIIDLDITEALAIESKFDEDLFKIAETISY"
     atgaaaacca taggtgtttt aacaagcgga ggagattctc caggaatgaa cgcagcgata        60
     agagcagtgg tacgtacagc acttcagaat aacataagag tagtagggat acaacgagga       120
     tatagtggac taataaatgg cgaaattacc gaattaacaa gagatagcgt ttctgatatt       180
     attcagcgtg gaggtacaat ccttaaaaca gctaggagca atacctttag gactgaagaa       240
     ggaagaagaa gagcagcgga tgtgttaaag gtctttggag ttgaaggact tgtagtagtt       300
     ggcggtgatg gttcctttat gggggctaag cttttatcag acctaggagt tgctactata       360
     ggactacctg gtactataga caatgatttg gcatatacag attatacaat tggcttcgat       420
     acagcattaa atacggtcat agatgctgtg aataaattaa aggatacatc tagttctcat       480
     gaaagagcga gtgtcgttga agtaatggga agaaattgtg gtgacatagc tttgtactcc       540
     ggtcttgctg gcggtgcaga aagcatcatt cttccagaaa aaccttttga tatggatgaa       600
     ctatgcaggg ggattttaga aggaaaaatg agaggcaaat tacataattt aataatggta       660
     gcagaaggtg tcggaaaagc agaagaaata gcaaaaaaga tagaagatat cacaggaatt       720
     gaagctagag tcacaaaact tggacacata caaagaggtg gaagtcctac agttgcggat       780
     agagtattag ctacaagaat gggatataga gcagttgagt tgctacgtga gggaaagtct       840
     gccagagtcg ttgggataaa aaataataaa ataatagatt tagatataac agaagcctta       900
     gcaattgaaa gtaaattcga tgaggatctg tttaagattg ccgaaacaat ttcatactag       960
//

If you have problems or comments...

PBIL Back to PBIL home page