(data stored in ACNUC7421 zone)

EMBL: CP002160.PE38

CP002160.PE38        Location/Qualifiers
FT   CDS_pept        75485..76390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0040"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dth:DICTH_0039
FT                   transmembrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49829"
FT                   /db_xref="GOA:D9SMP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL49829.1"
FT                   /translation="MEAVKAKKKRDIGAFDIFLYVLMILVMIATLYPFLNVLAISLNDS
FT                   MDTIKGSNFIIPREFTFDNYKEIFKYNNLVSAFFMSVLRTAVGTFTAVICTAMLAYVFS
FT                   RRDYAFNRPVVVLFVITMYVSGGMIPEYMLIKNIGLVGKFSVYIIPALISVFNVIVMRS
FT                   FIDGIPISLQESARIDGANDFVIFYKIIMPLCIPVLATISLFVAVGQWNSWFDTYLYSA
FT                   GKAWLSTLQFEMIKIMDNTNATTAISQAQVNSNSVTNAVVSPQSIRMALTITATVPILL
FT                   VYPFVQKYFVAGMTLGAVKS"
     atggaagctg taaaggcgaa aaagaaaaga gatataggag catttgatat atttctatat        60
     gtattaatga tattagttat gattgcaacg ttgtatccat tcctaaatgt attagcaata       120
     tcattaaatg attcaatgga tacaataaag ggttctaatt ttataatacc aagagagttt       180
     acttttgata actataaaga aatattcaaa tataacaatc tagtgagtgc gttctttatg       240
     tctgtattaa gaactgcagt tggaacattt acggcagtta tctgtacagc aatgcttgct       300
     tatgtattta gtagaagaga ttatgctttc aatagaccag tagttgtact attcgttata       360
     actatgtatg ttagtggagg tatgattcca gaatatatgc ttattaagaa cattggactt       420
     gtaggaaagt tctcagtata tataattcca gctttaataa gtgtattcaa tgttatagtt       480
     atgagatctt ttattgatgg tattccgata tcattacaag aatcagctcg tatagacggt       540
     gctaatgact ttgttatatt ctataaaata ataatgccat tatgtatccc agttttagct       600
     acaatatcat tattcgtagc agttggacaa tggaactctt ggtttgatac ttacttatat       660
     agtgcaggaa aggcatggct cagtacgtta caatttgaaa tgatcaagat catggataat       720
     acaaatgcca ccacagcaat ttcacaggca caagtaaact caaactctgt aacaaatgca       780
     gtagtttcgc cacaatctat tagaatggcg ttaactataa cagctactgt accaatatta       840
     cttgtatatc cttttgttca aaaatacttt gttgctggta tgacattagg agctgttaag       900
     agttaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page