(data stored in ACNUC7421 zone)

EMBL: CP002160.PE380

CP002160.PE380       Location/Qualifiers
FT   CDS_pept        500415..502802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0391"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; carbohydrate binding;
FT                   glycosyltransferase 36 associated; KEGG: cpy:Cphy_1929
FT                   glycosyltransferase 36"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50171"
FT                   /db_xref="GOA:D9SQA4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037828"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA4"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADL50171.1"
FT                   /translation="MNYGYFDGENKEYVITKPNTPAPWANYLGSPEYGAIISNNAGGYS
FT                   FVKSGANGRIIRYRFNAINMDQPGRYIYLRDNDNGDYWSGSWQPVGKPLDKYENQCHHG
FT                   TAYTNIKSKYTNIKAETLYYVPLDKTYEVWRVKVTNEDTKVRNLSLYGYVEFSNENNYE
FT                   QDSVNLQYTQYITKTYFRNNKIIQTINENVKQSVNGSTGKERFFGVAGAEVAAYEGDRD
FT                   TFVGEYRNYSNPIAVESGKCQKVLNYNTNSCGALQIDITLNPGETKELAFVLGAHNDDA
FT                   SSKILASYEDLSQVEKELQELKDYWHGKLNNFQINTPDENFNHMINTWNSYQCFITFVW
FT                   SRAASFQYCGLRNGYGFRDTVQDIQGIIHLAPELALEKIKFMISGQVDNGGGLPLVKFD
FT                   HNPGHEMTPDDPAYTYDRYRADDALWLFPTILKYINETGNDDFLDEVIPFANKGEATVY
FT                   EHLKRAINFSMERQGNNGMPAGLHADWNDCLRMGAKGESTFVAFQLYYAMAILKNIATD
FT                   KKDDAYVAYLDEKLAELKETMQTKCWEGDQFIRGIREDGIVVGSKNDPEANLWLNPQSW
FT                   AVISGCADKEQCEKALDKVYERLNTPYGAVLLDPPYKDHAFDGALMLLFNPSTKENGGI
FT                   FSQSQGWIILAEALMGRGNKAFEYYRECSPAEMNDNAEVRKLEPYAHGQFIEAKESPFQ
FT                   GRAHVHWLTGTASTVMVGCVEGILGMRPTVDGLNISPSVPSDWKEFSIFKSFRGKKLNI
FT                   LVKNPDGKEGGVRELIVNGEKVEGSFLPVSMLKEENEIIATM"
     ttgaattacg gttatttcga tggagaaaat aaagagtatg ttatcacaaa acctaataca        60
     ccagcacctt gggcaaacta tttaggatcc ccagaatatg gtgctattat ttcaaataat       120
     gcaggcggat atagctttgt taagtctgga gcaaacggaa gaataattcg ttaccgtttc       180
     aatgccatca atatggacca gcctggaaga tatatttatt taagagataa tgataatgga       240
     gactattggt ctggatcttg gcaaccagta ggtaaacctt tagataagta cgaaaatcaa       300
     tgtcatcatg gaactgcata tacaaatatt aagtcgaaat atacaaatat aaaagctgaa       360
     actttatatt atgttccact tgataaaact tatgaggtat ggcgtgtaaa ggtaaccaat       420
     gaagatacta aggtaagaaa cctttctctt tatggttatg ttgaattttc aaatgaaaac       480
     aactacgaac aagattcagt aaatcttcaa tatactcaat acataacaaa gacttatttt       540
     agaaacaaca aaattattca aactataaat gaaaatgtta aacaatcagt aaatggaagt       600
     actggaaaag aaagattttt tggagttgca ggtgcagaag ttgcagctta tgaaggagat       660
     agagatactt tcgtaggtga atatagaaat tattcaaacc ctatagctgt tgaaagtggt       720
     aaatgccaaa aggtattaaa ctataacaca aactcttgtg gagcacttca aatagatatt       780
     actttaaacc caggagaaac taaggaatta gcatttgtat taggagcaca taatgatgat       840
     gcttcatcaa aaatattagc tagctatgaa gatttatctc aagtagagaa agaacttcaa       900
     gaattaaaag attattggca tggaaagtta aataacttcc aaatcaatac tccagatgaa       960
     aacttcaacc acatgataaa cacttggaac tcataccaat gctttataac atttgtatgg      1020
     tcaagagcag catcattcca atattgtgga ttaagaaatg gttatggctt cagagatact      1080
     gttcaagata tccaaggtat aatacatctt gctccagaac tagctttaga aaaaataaag      1140
     tttatgatat caggacaggt tgataatggt ggtggattac ctttagttaa gtttgatcat      1200
     aaccctggtc acgaaatgac accagatgat ccagcgtata cttatgacag atacagagca      1260
     gacgatgctt tatggttatt cccaacaatc cttaagtata taaatgaaac aggaaatgat      1320
     gatttccttg atgaagtaat tccttttgct aataaagggg aagctactgt ttatgaacac      1380
     ttaaagagag ctatcaactt tagtatggaa agacaaggta acaacggaat gcctgctggt      1440
     cttcatgcag actggaatga ttgcttaaga atgggagcta agggagaatc aactttcgtt      1500
     gcattccaac tttactatgc tatggcaatc ttaaagaata ttgcaactga caagaaagat      1560
     gatgcttatg tagcatatct tgatgaaaag ttagcagaac ttaaagaaac tatgcaaact      1620
     aagtgctggg aaggcgacca attcataaga ggtatcagag aagatggaat tgttgttggt      1680
     tctaaaaatg atccagaagc aaatctatgg ttaaatccac aatcttgggc tgttatcagt      1740
     ggttgtgcag acaaagaaca atgtgaaaaa gcacttgata aagtatatga aagacttaac      1800
     actccatatg gagctgtact tctagatcca ccatacaaag accatgcatt tgatggagct      1860
     ttaatgttat tattcaaccc ttctacaaaa gagaatggag gaatattctc acaatctcaa      1920
     ggttggatta tattagcaga ggctttaatg ggtcgtggaa ataaagcatt cgaatactac      1980
     agagaatgta gcccagcaga aatgaacgat aatgctgaag taagaaagct tgagccatat      2040
     gctcatggac aatttatcga agctaaagaa agcccattcc aaggaagagc tcacgttcat      2100
     tggttaacag gaacagcttc tactgttatg gttggttgtg ttgaaggtat cttaggaatg      2160
     agaccaacag ttgatggatt aaatatatca ccatcagttc catcagattg gaaagaattc      2220
     tctatattca agagcttcag aggcaagaaa ttaaatattc ttgttaagaa cccagatggt      2280
     aaagaaggcg gagtaagaga attaatcgta aacggagaaa aggttgaagg aagcttcctt      2340
     ccagtttcaa tgttaaaaga agaaaacgaa ataatagcaa caatgtag                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page