(data stored in ACNUC7421 zone)

EMBL: CP002160.PE382

CP002160.PE382       Location/Qualifiers
FT   CDS_pept        504767..505936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0393"
FT                   /product="malic protein NAD-binding"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: clo:HMPREF0868_0752 malic enzyme, NAD
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50173"
FT                   /db_xref="GOA:D9SQA6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA6"
FT                   /inference="protein motif:PFAM:PF03949"
FT                   /protein_id="ADL50173.1"
FT                   /translation="MSNIYDIALEKHGNWKGKLSVEVKVPMETREDLSIAYTPGVAEPC
FT                   RKIHQNKEDVYKYTWKGNSVAVVTDGTAVLGLGDIGPEAALPVMEGKAILFKQFAGIDS
FT                   VPICLNTKDPKEIIAICKAIAPGFGGINLEDISAPRCVEIERALKKELNIPVFHDDQHG
FT                   TAIVVTAGLINALKVVGKKKEDVTVVVSGAGAAGSSIIKMLLDFGVKEVYGFNINGIIS
FT                   MENYDSYDFLTKELAEITNKANKQITMAEALKEADVFIGVSAPRILTKEMVQAMKKDPI
FT                   VFAMANPEPEITYEDAKAAGAKVVGTGRSDFPNQVNNVLAFPGLFKGALMSRAEQITEE
FT                   MKLAAAVGIASIISDEEVNEDYVIPSAFNEKVAEIVAKEVARVAEEQRQ"
     atgagtaata tttatgatat agcgttagaa aagcacggga attggaaagg taagctttct        60
     gtagaggtta aggttccaat ggagacaaga gaagatcttt ctatagctta tacaccagga       120
     gtagctgagc cttgcagaaa aattcatcaa aataaagaag atgtatataa atatacttgg       180
     aaaggtaatt ctgtagctgt tgttactgac ggaactgcag ttttaggact tggagatata       240
     gggcctgagg cagcacttcc tgtaatggaa ggaaaggcta ttctatttaa gcaatttgca       300
     ggaattgatt cagttccaat ttgtcttaat acaaaagatc caaaggaaat tatagcaata       360
     tgtaaagcta tagctccagg ttttggtgga atcaatcttg aagacatttc agctccaaga       420
     tgtgtagaaa tagaaagagc tttaaagaaa gaacttaaca tacctgtttt ccatgatgat       480
     caacatggaa cagcaatagt tgttactgca ggacttatca acgctctaaa agtagttggt       540
     aaaaagaagg aagatgtaac ggtagttgta agtggtgctg gtgcagcagg aagttctatt       600
     ataaagatgt tattagactt tggagtaaaa gaagtttatg gatttaatat caacggaatt       660
     atatccatgg aaaattacga ttcatatgat tttctaacaa aagagttagc tgagataaca       720
     aataaagcta ataagcaaat aactatggca gaagctctta aagaagctga tgtattcatc       780
     ggtgtatctg ctccaagaat attaacaaag gaaatggttc aagctatgaa aaaggaccct       840
     atagtttttg ctatggcaaa tccagaacca gaaattactt atgaagatgc aaaagcagca       900
     ggagcaaaag ttgttggaac aggaagatca gacttcccta accaagttaa taacgtgtta       960
     gctttcccag gtttatttaa gggcgctctt atgtcaagag cagaacaaat tacagaagaa      1020
     atgaagctag ctgcagctgt tggtattgct tcaataataa gtgatgaaga agtaaatgaa      1080
     gattatgtaa ttccatctgc cttcaacgaa aaggttgctg aaatagtggc taaagaggtt      1140
     gcaagagtag ctgaggaaca aagacaataa                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page