(data stored in ACNUC7421 zone)

EMBL: CP002160.PE383

CP002160.PE383       Location/Qualifiers
FT   CDS_pept        complement(506066..506593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0394"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbe:Cbei_3606 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50174"
FT                   /db_xref="GOA:D9SQA7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50174.1"
FT                   /translation="MNINFQLGTKDDINELEQLYNDLNDYLASGTNYPGWIKGIYPVRQ
FT                   NAVDGINSNNLYVAKHNGKIIGSIILNHKPDPTYHTVNWGLDLDYSKVFVIHTFLVHPQ
FT                   FLKSGVGNALIDFAINQGIKSQVKAIRLDVYEGNIPAIKLYEKFSFKYIDTVDLGLINQ
FT                   GLNWFKLYEKLL"
     atgaatataa attttcaatt aggaacaaaa gatgatatca atgaacttga acaactttat        60
     aacgatttaa atgattattt agcaagtggg acaaattatc ctggctggat aaagggtata       120
     tatcctgttc gccaaaatgc agttgatgga ataaactcta ataatctata tgttgcaaag       180
     cataatggaa aaattattgg ctctattatc ttaaatcata agcctgaccc tacctatcat       240
     acagttaatt gggggctaga ccttgactat tcaaaggttt tcgttataca caccttttta       300
     gtacatcctc aatttttaaa atctggagtt ggtaatgcat tgatagattt tgctattaac       360
     cagggtatta aatcacaagt taaagcaatt agacttgatg tttacgaagg aaatattccg       420
     gcaattaagt tatatgaaaa atttagcttt aaatacattg atactgttga cttaggactt       480
     ataaatcagg ggctaaactg gtttaaatta tatgagaaac tactctag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page