(data stored in ACNUC7421 zone)

EMBL: CP002160.PE384

CP002160.PE384       Location/Qualifiers
FT   CDS_pept        506959..508377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0395"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="KEGG: cno:NT01CX_1299 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA; TIGRFAM: RNA
FT                   methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase; deoxyribonuclease/rho
FT                   motif-related TRAM"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50175"
FT                   /db_xref="GOA:D9SQA8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA8"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ADL50175.1"
FT                   /translation="MLEFIRIGDEMKREAPVKKNEEYIIDINGMGYEGEGVGKIDNFTV
FT                   FVPGALKGEKVKVLIVKVNKNFGFGKLKEVIEPSKDRVAPACEIYEKCGGCQLQHLSYK
FT                   GQLEFKKSRVQDCIERIGGFDLSEDNIQLHETLGMENPYRYRNKVQLPVGGTVEDVKIG
FT                   FYSQRSHNIIDMESCNIQFEEADTVVDIVKQWMQENKIQPYNEETHTGIVKHIMVRKAF
FT                   NNDELMVVVVTNGKSLPKKEILIKELQDSFNNLVSVVQNVNDKKTNVVLGLDNVTLFGK
FT                   DTISDYIGEFKFNISPLSFFQVNPVQTEVLYNKALEYAGLTGNEVVFDAYCGTGTISLF
FT                   LSKKASKVYGVEIIEAAIENANINAKENKIDNAEFFVGKCEDVIPKLIADGVKADVVVV
FT                   DPPRKGCEKSLLDALVSMSPERIVYVSCDPGTLARDLRILCDMGYDLKEVQPVDMFPET
FT                   GHVESVVLITRKDR"
     atgttagaat tcataagaat aggtgatgag atgaaaagag aagctccagt aaagaaaaat        60
     gaagaataca taattgatat aaatggaatg ggttatgaag gtgaaggagt aggcaagatt       120
     gataatttta cagtctttgt cccaggtgct ttaaagggtg aaaaggtaaa agtattaata       180
     gtaaaggtca ataaaaattt tggctttggt aagctaaaag aagttataga accatcaaaa       240
     gacagagtag ctccagcttg tgagatatat gaaaaatgtg gtggctgtca attgcagcat       300
     ctaagttata aaggtcagct agaatttaaa aagagtagag tgcaagactg tatagagcga       360
     attggtggtt ttgatttatc agaagataat atacagcttc atgagacttt aggaatggag       420
     aatccatata gatatagaaa taaagttcag ttgccagtgg gtggaaccgt tgaagacgta       480
     aaaataggtt tttacagcca aagaagtcac aacatcatcg atatggaaag ctgcaatata       540
     caatttgaag aagctgatac tgtagtagat atagtaaaac agtggatgca ggaaaataaa       600
     attcagccat acaatgagga aactcatact ggaatagtta agcatataat ggtgagaaaa       660
     gcctttaata atgatgaact tatggtagtt gtagtgacta acggaaaaag tcttccaaag       720
     aaggagatac tgataaaaga attacaagat agttttaaca atttagtaag cgttgttcag       780
     aatgttaacg ataaaaagac aaacgtagtt ttaggtcttg acaatgttac cctatttggt       840
     aaggatacta tttcggatta tataggcgaa tttaagttca atatatctcc attatccttt       900
     ttccaagtta accctgttca gacagaagtt ctttacaaca aggccttaga atatgcagga       960
     cttacaggca atgaagttgt ttttgatgct tattgtggta ctgggactat ttctttattt      1020
     ttatctaaaa aggcttcaaa ggtttatggt gtagaaataa ttgaagctgc aattgaaaat      1080
     gcaaatatca atgctaaaga aaacaaaata gataatgcgg aattttttgt gggtaaatgt      1140
     gaagatgtta ttccaaagtt gattgctgat ggtgttaagg ctgatgttgt ggtggtagat      1200
     cctcctagaa agggttgtga gaaatctttg cttgatgcgt tggtttctat gagtcctgaa      1260
     agaattgttt atgtttcttg tgatcctggt actttggcaa gggatttgag gattctttgt      1320
     gatatgggtt atgatctaaa ggaagtgcag ccagtggata tgttcccgga gacgggacat      1380
     gtggagagtg ttgtattgat aacaagaaaa gataggtaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page