(data stored in ACNUC7421 zone)

EMBL: CP002160.PE386

CP002160.PE386       Location/Qualifiers
FT   CDS_pept        510480..511052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0398"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ckl:CKL_2572
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50177"
FT                   /db_xref="GOA:D9SQB0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL50177.1"
FT                   /translation="MKYDLNNKTNRFAQRTLLAFSSSLMEILETKGFERITVGEICEAC
FT                   NYPRATFYNYFDDSYDLLNYCWIAMMQEIKVDDYPYMKPEERVYIIFERIYDYFDSYRE
FT                   RLGKIMMFNSLDGALVTSCNLFVKQQSSQIMMDCPYGDVHPIPHQLVAEHYSNTLQLII
FT                   EWCFLRKKIDSKEDALKYLHYLLRNIG"
     atgaaatatg atttaaacaa taaaacaaat agatttgcac aaagaacatt actggcattc        60
     tcatcatcat taatggaaat actggaaaca aagggatttg aaaggataac ggtaggtgaa       120
     atctgtgaag cttgcaatta tccgagagca accttttaca actattttga tgatagctat       180
     gatctgctga attactgttg gattgccatg atgcaggaaa taaaagtaga tgactatcca       240
     tatatgaaac ctgaggaacg agtgtatatt attttcgaac gaatttatga ttattttgat       300
     tcctatcggg aacgacttgg aaaaattatg atgttcaatt ctctagatgg agcattggtg       360
     acgtcatgca atctctttgt aaaacagcag agcagtcaaa ttatgatgga ttgtccatat       420
     ggggatgtgc atccgattcc acaccagcta gtggctgaac actacagtaa tacccttcag       480
     ctcattatag agtggtgttt cttaagaaag aagattgatt caaaagagga tgcgctaaaa       540
     tatctgcatt atcttctaag aaatatagga taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page