(data stored in ACNUC7421 zone)

EMBL: CP002160.PE389

CP002160.PE389       Location/Qualifiers
FT   CDS_pept        514800..515546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0402"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /EC_number="2.4.1.187"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; KEGG: tit:Thit_1850 glycosyl transferase,
FT                   WecB/TagA/CpsF family; PFAM: glycosyl transferase
FT                   WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50180"
FT                   /db_xref="GOA:D9SQB3"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR034714"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB3"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADL50180.1"
FT                   /translation="MNNYVDILGISFSKLNLQETINLIDNKIEKYRSQLFHIITVNPEI
FT                   AIEIQEDSELRKISLEADLITPDGIGIVLASRLKRNPVPERVTGYDLLLESLKVGNSKG
FT                   WSFYFLGSDEEVNKKTAEYVMKNYPNVKIAGRHHGYFNKEEELKIVENIKSAKPDILIV
FT                   ALGSPLADKWIYKNKTQLNSKVVFGVGGSLDVITGKVKRTPEVWKKLNLEWLFRRINEP
FT                   SRKERQKKLKVFAYRAFGEAFNKNIK"
     gtgaataatt acgttgatat tttaggtata tcattttcaa aattaaatct acaagagaca        60
     attaatttaa tagataataa gatagaaaaa tatagaagtc agctatttca tattattact       120
     gtgaatccag aaattgcgat agagattcag gaagactctg agctaagaaa aatatcactt       180
     gaagcagatt taataacacc tgatggaatt ggcattgttt tagcgtcaag attaaagcgt       240
     aatccagtac cggagcgtgt tacaggttat gatttgcttt tagaatctct taaagtggga       300
     aattcaaagg ggtggtcatt ttattttttg ggttcagatg aagaagtaaa taaaaagact       360
     gcagaatatg ttatgaagaa ttatcctaat gttaaaattg caggtagaca tcatggttat       420
     tttaataaag aagaagaact caaaattgtt gaaaatataa aaagtgcaaa gccggatatt       480
     cttatagttg cattaggttc accacttgca gataaatgga tatataaaaa caaaactcag       540
     cttaactcta aagtggtttt tggtgtagga ggaagtcttg atgtaattac gggaaaagtt       600
     aaacgaacac cagaagtttg gaaaaagtta aatttagagt ggttatttag gagaataaat       660
     gaaccttcac gaaaagaaag acagaaaaaa ttgaaggttt ttgcatacag agcatttggt       720
     gaagcattta ataaaaatat aaagtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page