(data stored in ACNUC7421 zone)

EMBL: CP002160.PE39

CP002160.PE39        Location/Qualifiers
FT   CDS_pept        76532..78565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0041"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="KEGG: gym:GYMC10_5609 beta-galactosidase; PFAM:
FT                   Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49830"
FT                   /db_xref="GOA:D9SMP5"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP5"
FT                   /inference="protein motif:PRIAM:3.2.1.23"
FT                   /protein_id="ADL49830.1"
FT                   /translation="MKNLSSIFYGGDYNPDQWPDEIYQEDMRLFKLAGINIITIPVFSW
FT                   ALLQPSEDEYKFEWLDKILDLAWENGISVCLATSTAAQPSWMSKKYPEMLPVDFYGRRR
FT                   KHGGRVNFCPNNEKYHEFSTKLTGLMAERYKNHPAIALWHIGNEYGNYCYCDKCEEEFR
FT                   NWAKKRYGTIENLNKKWYLNFWGHTIYDWDEIVIPSGLSEVWMDGWTAKTNFQSIAIDY
FT                   NRFMSESVFNCYKAEYDIIKNITPEIPITTNLMGTFKPLDYFKWAEYMDIISWDNYPSL
FT                   TDPMFKTAMRHDLMRGLKDGKPFLLMEQTPSQQNWQPYNSVKRPGVLRLQSYQTLAHGA
FT                   DAIMFFQLRQSIGACEKYHGAVISHAGHENTRVFKELTQIGDELKALGDKTIDSRMQAK
FT                   VAIVFDWENWWAVEFSSGPSKDLNYVEQVEKYYEAFYNMNIAVDMVKPEADLSQYKIVV
FT                   APVLYMLRPGVAKNFESYVENGGTFVTTFFSGYVDETDIVKVGGYPGELRKLLGLWVEE
FT                   IDAIFPDMSNSIVMKETVGKLEKEYISKMLCDILNVETAKVLAVYGKDFYAGKPALTVN
FT                   NFGKGKAYYIATDPEQSFIAGLMEVLCEDNSITAPFQAKAGVEIAQRFKDDKEITFIMN
FT                   YNDEDVVINLKDENYIDLIKNKGKKGEILIKSKDVLVLERKI"
     atgaaaaact taagctctat attttatggt ggagattata atcctgacca atggccagac        60
     gaaatttatc aagaggatat gagacttttt aagttagcag gtattaatat cataacaatt       120
     cctgtattta gttgggcgct tcttcaacca tctgaagatg aatataagtt tgaatggtta       180
     gataaaattt tagatttagc atgggaaaat ggaataagtg tttgtcttgc tacttccaca       240
     gctgcacaac cttcgtggat gtcaaaaaag tatccagaaa tgctaccagt agatttctat       300
     ggaagaagac gtaaacacgg tggtagagta aacttctgtc caaacaatga gaaataccat       360
     gaattttcaa caaagctaac aggtcttatg gcagaaagat ataaaaatca tccagctata       420
     gctttgtggc atattggaaa tgaatacggt aattattgct attgtgataa atgtgaagaa       480
     gaatttagaa actgggcaaa gaagagatat ggaactattg agaacttaaa taaaaagtgg       540
     tacttaaact tctggggaca tacaatatac gattgggatg aaattgttat tccttcagga       600
     ctaagtgaag tatggatgga cgggtggact gcaaaaacaa acttccaatc tatagccatt       660
     gattataata ggtttatgtc tgaatcagta tttaattgtt ataaagcgga atatgatatt       720
     attaaaaaca taacacctga aatcccaata actacaaatc tcatgggaac ttttaaacct       780
     ttagattatt tcaaatgggc agagtacatg gatataatat cttgggataa ctacccatca       840
     ttaactgacc ctatgtttaa aactgctatg aggcatgatc ttatgagagg cttaaaggat       900
     ggaaagccat ttttacttat ggaacagact ccaagtcagc aaaattggca accgtataat       960
     agcgtaaaac gtccaggggt tcttagactt caaagctatc aaacattagc acatggtgct      1020
     gatgctataa tgttctttca attaagacag tctattggag cttgtgagaa gtaccatgga      1080
     gcagtcatat ctcatgctgg acatgaaaat acccgcgtat ttaaagagtt aacacaaata      1140
     ggtgatgaac taaaagcgtt aggggataag actatagatt caagaatgca agctaaagtt      1200
     gcaattgttt ttgattggga aaattggtgg gcagtagagt tttccagtgg tcctagcaag      1260
     gatttaaatt atgttgaaca agtagaaaaa tattatgaag ctttctacaa tatgaatata      1320
     gctgttgata tggtaaaacc agaagcggat ttatctcaat ataaaatagt tgtagcacca      1380
     gttttatata tgcttagacc aggtgtagca aagaattttg aaagttatgt cgaaaatggt      1440
     ggaaccttcg taactacatt ctttagtggt tatgttgatg aaacggatat agtaaaagtt      1500
     ggtggatatc caggtgaatt aagaaaatta cttggattat gggtagaaga gattgatgct      1560
     atatttccag atatgagtaa tagtatcgta atgaaagaaa cagtaggaaa actagaaaaa      1620
     gaatacataa gtaaaatgtt atgcgatatt ttaaatgttg aaactgcaaa agtattagcg      1680
     gtttatggaa aagatttcta tgcaggtaaa cctgcgctta ctgtaaataa ttttgggaaa      1740
     ggtaaagctt attatatagc tacagatcca gaacaaagtt tcatagctgg acttatggaa      1800
     gttttatgtg aagataacag cataacagct ccttttcaag ctaaagcagg agtagaaatt      1860
     gcccaaaggt ttaaggatga taaagaaatt actttcatta tgaactacaa tgatgaagat      1920
     gtagttataa accttaaaga tgaaaattat atagatttaa taaaaaataa aggtaaaaaa      1980
     ggagaaatat taattaagtc caaagacgtt ctggttttag aaagaaagat ataa            2034
//

If you have problems or comments...

PBIL Back to PBIL home page