(data stored in ACNUC7421 zone)

EMBL: CP002160.PE390

CP002160.PE390       Location/Qualifiers
FT   CDS_pept        515903..516376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0403"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   cac:CAC3531 IS605/IS200-like transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50181"
FT                   /db_xref="GOA:D9SL34"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D9SL34"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ADL50181.1"
FT                   /translation="MDNSSLAHSKWNCKYHIVFAPKYRRQIIYGKIKADIGVILRKLCE
FT                   HKGVEIIEANACKDHIHMLVSIPPKLSVSQFMGYLKGKSSLMIFDRHANLKYKYGNRQF
FT                   WCKGYYVDTVGRNKKIIEEYIKNQIQEDLAYEQMSLKEFIDPFTGESVNKGKK"
     atggataata gtagtttagc acatagtaaa tggaattgta aatatcacat agtcttcgca        60
     ccaaagtata ggagacaaat catatatgga aaaataaaag cggatatagg ggtaatactt       120
     agaaagttat gtgaacataa aggagtagaa attattgaag caaatgcatg taaggatcat       180
     atacatatgc ttgtaagtat acctccgaag ttaagtgtct ctcagtttat ggggtatttg       240
     aaaggtaaga gttcattgat gatttttgac agacatgcaa atttgaaata taaatatggg       300
     aataggcaat tttggtgtaa aggctattac gttgatacag ttggaagaaa caaaaagata       360
     atagaagaat acataaagaa tcaaatacag gaagatttag catatgaaca aatgagcttg       420
     aaagaattta ttgacccgtt tacgggtgaa tcagtaaaca aaggcaaaaa ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page