(data stored in ACNUC7421 zone)

EMBL: CP002160.PE392

CP002160.PE392       Location/Qualifiers
FT   CDS_pept        517959..518762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0405"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: lbf:LBF_2413 AraC-family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50183"
FT                   /db_xref="GOA:D9SQB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL50183.1"
FT                   /translation="MATFDQQSIYIKDLPSSLAKMGFQFYQSKNIEDGLVTLPAFTGVR
FT                   INFIFDGKSVASGVLKSGDLMIAGYTDSPLYGNVYNFSMASIGIHFSLFYYLTGLFPRQ
FT                   CRIPYKVPENSRIYSDLVPFFFLPRENWDSHALSIIKKNQLVLNKVVIKQMERVSLATQ
FT                   LYGYNQMKGFQDISNELGISYRQLQRDFHAFLGMTPSQYERLLRYQVAALNIKNTSIIE
FT                   VALSSGYYDQAHMIREFKKFSDKTPRQIAELNDITVPFVDRKIDL"
     atggcaactt ttgaccaaca atctatatac attaaagact taccttcatc gctggctaaa        60
     atggggtttc aattctatca aagcaagaat atcgaagacg gacttgttac gttaccggct       120
     tttacgggag taagaataaa ctttattttt gatggtaaaa gtgttgctag tggtgtatta       180
     aaatctggtg acttgatgat tgctggatac actgactctc ctctttatgg aaatgtctat       240
     aatttttcaa tggcatctat tggaatacat ttttcactat tttactattt aacaggcttg       300
     tttcccagac aatgtaggat accatataaa gttccagaaa atagtagaat ctattctgat       360
     ttagtaccat ttttctttct cccaagagaa aactgggatt cacatgcctt atcaatcatt       420
     aaaaagaatc aactagtttt aaataaagta gttattaaac agatggaaag agttagtctg       480
     gcaacgcagt tatatggcta taaccagatg aaaggatttc aggatatttc caatgaacta       540
     ggaatttcat atcgacaatt gcaacgggat tttcatgcat ttttaggaat gactccttcc       600
     caatatgagc gattattgcg ctatcaggtt gctgcattaa atattaaaaa taccagcatt       660
     atcgaagtgg cactatcgtc aggatattat gaccaagctc atatgattag agaatttaaa       720
     aagttttctg ataaaacacc aagacagata gcagagttga atgatataac agttcctttt       780
     gttgatagga agattgatct atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page