(data stored in ACNUC7421 zone)

EMBL: CP002160.PE395

CP002160.PE395       Location/Qualifiers
FT   CDS_pept        521339..522082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_0694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50186"
FT                   /db_xref="GOA:D9SQB9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029478"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB9"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0694"
FT                   /protein_id="ADL50186.1"
FT                   /translation="MKELYDMIFKRKSFRKFNDALSFSEEELQDINEEIKRLIPLITGI
FT                   EVKYEIVPREKTTCKRGECCLLIYSEEKEHYLLNVGYMFEQLDLYLASRNIGVCWYGMG
FT                   KVNETQYNNLPYVIMLALGKAEENQFRKDYRKSKRKETSDIWKGDLSFEIAEFVKYAPS
FT                   ACNTQPWRVVCENHTLKIYRITEIKSIIPKEKVSFYNSIDMGIFLYFVELALSHNKISF
FT                   QRTLSPENNEADLIPIGIYMLKKEG"
     ttgaaggaat tatatgacat gatttttaaa agaaaatcat ttagaaagtt taatgatgca        60
     ttgtcttttt cagaagaaga attgcaggat ataaatgaag aaataaaaag attaattcct       120
     cttataactg gaatagaagt aaaatatgaa attgttccaa gagaaaagac tacctgtaaa       180
     cgtggggaat gctgtttact tatttatagt gaagaaaagg agcattactt actaaatgtt       240
     ggttatatgt ttgagcaact ggatttatat ttagcttcaa gaaacatagg tgtatgttgg       300
     tatggaatgg gaaaagtaaa tgagactcaa tacaataatt tgccatatgt aataatgctg       360
     gctttgggaa aagcagaaga aaatcagttt aggaaagact atagaaaaag taagcgaaaa       420
     gaaacaagtg acatatggaa aggggatttg agctttgaaa tagctgagtt tgttaaatat       480
     gccccaagtg cttgtaatac tcaaccctgg cgagttgttt gtgaaaatca tactttaaaa       540
     atatatcgaa taacagaaat taaatcaatt ataccaaaag aaaaagtatc tttttataat       600
     tcaatagata tgggtatttt tctatatttc gtggaactag ctttatccca caataaaatt       660
     tcatttcaaa gaaccttgag tcctgaaaat aatgaagctg atttaatacc tataggaata       720
     tacatgttaa agaaagaagg ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page