(data stored in ACNUC7421 zone)

EMBL: CP002160.PE397

CP002160.PE397       Location/Qualifiers
FT   CDS_pept        523175..524053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0410"
FT                   /product="Chorismate mutase, type II"
FT                   /note="PFAM: Chorismate mutase, type II; glutamine
FT                   amidotransferase class-I; KEGG: wsu:WS2172 anthranilate
FT                   synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50188"
FT                   /db_xref="GOA:D9SQC1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC1"
FT                   /inference="protein motif:PFAM:PF01817"
FT                   /protein_id="ADL50188.1"
FT                   /translation="MILIITNNDERTNSFVECIKKVAKTEVKIIQDKEVSIEKISKLQP
FT                   DSIIISLKYKKDLETGSFKEILEKYKSVIPILGVAGGYAIIAEYFGCEIVELNNNNDAL
FT                   ITCDTNEELFKDFPLSFNAMGGQSIYINKDKLVDQVISIAFSEESAQIEAIKHRNYPVY
FT                   GVRFYPDFINNNDDLIIIRNFLSINDKICLDDSEIIKVKMGQIRKNIDEIDRKIVRLLS
FT                   KRNANVKEASKYKKTSSDVVAEDRIKDVLQKVRTIASAEEIDPDLVVRIYEFIIRSFIA
FT                   YEMSEFEKNKK"
     atgatactaa ttataactaa taatgatgaa cgtacaaata gttttgtaga gtgtattaag        60
     aaagtcgcaa aaacagaagt taaaattatt caggataaag aagtttctat tgagaaaatt       120
     tcaaaattac aaccagattc tataattatt tctttaaaat ataaaaagga tttggaaact       180
     ggaagtttta aagaaatcct tgagaaatat aaaagtgtta tacctatatt aggggttgct       240
     ggtggatatg caataattgc agagtacttt ggatgcgaaa tagttgaact taataacaat       300
     aatgatgctt taattacttg tgatactaat gaagaattat ttaaagattt tcctttatca       360
     tttaatgcaa tggggggtca atcaatttat ataaataaag ataagttagt agatcaagtt       420
     atatcaatag cattttcgga agagagtgct caaatagaag caataaaaca taggaactat       480
     ccagtatatg gtgtgagatt ttatccagat tttataaata ataacgatga cttgattatt       540
     ataaggaatt ttttaagtat taatgacaag atttgtttag atgactcaga aattataaag       600
     gtgaaaatgg gacaaataag gaaaaatatc gatgaaatcg acaggaaaat tgttagattg       660
     ttatcaaaga gaaatgccaa tgttaaagaa gcgtcaaaat ataaaaagac atctagtgat       720
     gtagtagcag aggatagaat aaaagatgtg ctgcaaaaag taagaacgat tgcgtcagca       780
     gaagaaattg atcctgactt agttgttagg atttatgaat ttattatacg aagcttcata       840
     gcttatgaaa tgagtgaatt tgaaaaaaac aaaaaataa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page