(data stored in ACNUC7421 zone)

EMBL: CP002160.PE398

CP002160.PE398       Location/Qualifiers
FT   CDS_pept        524190..525203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0411"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   cac:CAC2432 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50189"
FT                   /db_xref="GOA:D9SQC2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC2"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADL50189.1"
FT                   /translation="MNIFENITKSSIIKKMAIIGVIIAIIYMLKSMINLLLLTFIFTFI
FT                   FSQIHKFVYTKVNSWIKLSSKMVTISVYVIILAIIVIMSIRYIPQVTQQLIDIINLLST
FT                   FNLEQVHDKVGDTIFNIIKEIQIQDYLKQSEDKIIELATQIGTFSMNVVIAFLLSFFFI
FT                   LEKEEIIAFGQRLEGSKLAFAYEYCKYCGGIFLNSFGKVIQLQIVIAFINSVLSVIALA
FT                   IMGFPQALGIGTMIFILGLIPVAGVIVSLVPLSIIAFNIGGMVKIIEVIIMIAVLHALE
FT                   SYVLNPKLMSMKTKLPVFMVFVILLVGEHLMGVWGLLLGIPLFIFFLDIFDIKVEG"
     atgaatattt ttgaaaatat cactaagagc tctataataa aaaagatggc gattattgga        60
     gttattattg ctatcatata tatgttaaag agtatgataa atttattatt attgaccttt       120
     atatttacct ttatattttc tcagatacac aaatttgtat acaccaaagt gaacagttgg       180
     ataaaactca gtagtaagat ggtaacaata agtgtgtatg ttattatcct agccattata       240
     gtgataatga gtattagata tataccgcaa gtaacacaac aattgatcga tataattaat       300
     ttattatcga ctttcaattt agaacaagta catgataaag ttggagatac aatatttaat       360
     attataaaag aaattcaaat acaagattat cttaagcaaa gtgaagataa aattattgag       420
     ttagcaacac aaataggtac atttagtatg aatgttgtaa tagcatttct tttaagtttc       480
     tttttcatat tagagaaaga agagataatt gcttttggac aaagactcga aggtagtaag       540
     cttgcatttg catacgaata ctgtaaatat tgtggaggaa tattcctaaa ctcattcgga       600
     aaagttatac aattgcaaat agttattgca tttataaatt cagtattgtc agttattgct       660
     ttagctataa tgggatttcc tcaagcatta ggaattggta ccatgatatt tatacttgga       720
     cttattccag ttgcgggagt tattgtatct ttagtaccac tttctattat tgcttttaat       780
     atcggtggaa tggtgaaaat aattgaagtt atcattatga tagctgtact tcatgccctt       840
     gagagttatg tcttaaatcc taaattaatg tctatgaaga ctaagttacc tgtatttatg       900
     gtctttgtaa tattactagt aggcgagcat ttaatgggtg tatggggact gcttttagga       960
     attcctttat tcatattctt ccttgatatt tttgatataa aggttgaggg ctag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page