(data stored in ACNUC7421 zone)

EMBL: CP002160.PE4

CP002160.PE4         Location/Qualifiers
FT   CDS_pept        3443..4537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: cno:NT01CX_0864 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49795"
FT                   /db_xref="GOA:D9SML0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADL49795.1"
FT                   /translation="MFIENLKLRNFRNYKELNIDLYSGVNVFTGDNAQGKTNVLEAIYY
FT                   CSLGKSHRTNKDKELILWDALSGQLEVTVNKTRLNKKIKIDILKEGKKAISINSIKLKK
FT                   ISELIGICNVVMFSPEDLKIVKDSPSYRRKFLDIELCKLNSKYYFNLVQYNKVLNERNV
FT                   VLKSNNGNNLDIIEVYDMQLAKFGSHIVKDRVDYINKLNRYGQEIHKDITVSKEKISFS
FT                   YITDAKNLNGIEVELINLLKKNRQRDFIKKSTTVGPHRDDFSIEINDIDTRSYGSQGQQ
FT                   RTSILTIKFASLKIIKELIGEYPILLLDDVLSELDTNRQKYILNSIKDVQTVITCTGMN
FT                   EINNYLNDDYKLFIVNEGCIEEKI"
     atgtttatcg aaaatctaaa attaagaaat tttagaaatt ataaagaact taatatagac        60
     ttatatagtg gtgtaaatgt atttactggt gataatgctc aaggaaaaac aaatgtctta       120
     gaggctattt attattgcag tctaggtaaa tcacatagaa caaacaaaga caaagaatta       180
     atattatggg atgctttaag tggtcaactt gaagtaacag taaataagac taggttaaac       240
     aaaaaaataa aaattgatat tttaaaagaa ggtaaaaaag caatatcaat taattcaata       300
     aagttaaaaa aaatatctga gcttattgga atttgtaacg tagttatgtt ttcaccagaa       360
     gatttgaaaa ttgtaaaaga ctcaccatct tatcgtcgta agtttttgga tatagaactt       420
     tgtaagttaa actctaagta ttattttaat cttgttcaat ataataaagt tttaaacgaa       480
     cgaaatgttg tattaaagag taataatggc aataatcttg atataatcga agtatatgat       540
     atgcaactgg ctaaatttgg ttcacatatc gtaaaggata gagttgatta tataaataaa       600
     ttaaatagat atggacagga aattcataaa gacataaccg tttcaaaaga aaaaatttct       660
     tttagctata tcactgatgc aaaaaactta aatggtattg aagtggaact aattaaccta       720
     ctaaagaaaa atcgtcaaag agactttatt aaaaaaagta ctactgttgg acctcatagg       780
     gacgatttct ctatcgagat aaatgatatc gacactagga gttatggatc acaaggacag       840
     caaagaactt cgatcctgac tattaaattt gcctctctta agataattaa agaacttata       900
     ggagaatatc ctatactctt attagatgac gtactctctg agttagatac aaatagacaa       960
     aagtatattt tgaattccat aaaggatgtt caaaccgtaa ttacatgtac tggtatgaat      1020
     gagataaata attatctaaa tgatgattat aaacttttta ttgttaatga aggatgcatt      1080
     gaggagaaaa tttga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page