(data stored in ACNUC7421 zone)

EMBL: CP002160.PE405

CP002160.PE405       Location/Qualifiers
FT   CDS_pept        531414..532430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0418"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: aoe:Clos_0149 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50196"
FT                   /db_xref="GOA:D9SQC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50196.1"
FT                   /translation="MLKIEELEKEKIKDLEKQYPFILSFFENNKLDVKGYKEYTFQEYL
FT                   KHFTQEEIEEWAIDIEKMKIDLEIFINQMLEFLGVEKDRVDSITIIAGKDKYGNKENFD
FT                   KLTINKSEIISIVGPTGAGKSRLLADIEWAANKDTPTERVILINGEFPDKSLRFSTSNK
FT                   LVAQLSQNMNFIMDLSVKEFIELHARSRMIDNEEEVTNKILEAANELAGEKFNLDTPIT
FT                   GLSGGQSRALMIADTAILSTSPIVLIDEIENAGIDRKRALNLLVSKEKIVLMATHDPSL
FT                   ALMADKRIVIKNGGIYKVIETDREEKSILEELERMDTIISKMRTNLRNGDILEKEKV"
     atgcttaaga tagaagaatt agaaaaagaa aaaattaagg accttgagaa acaatatcct        60
     tttatactgt ctttctttga aaataacaaa ttagacgtaa agggttataa agaatatact       120
     tttcaagaat atttaaagca ctttacccaa gaagaaattg aagaatgggc aatagatata       180
     gagaagatga aaattgattt agaaattttt attaatcaaa tgctggaatt cttaggagta       240
     gaaaaagata gagtagattc tataactata attgccggta aagataagta tggaaataaa       300
     gagaattttg ataagttaac tattaataaa agcgaaataa tatctatagt gggaccaaca       360
     ggagctggaa aaagtagatt gttagcagat atagaatggg cagctaacaa agatactcca       420
     acggaaagag taatattaat taatggagaa tttccagata aaagccttag attttctaca       480
     agcaataaat tagtagctca attatcacag aatatgaatt ttattatgga cttatccgta       540
     aaagaattta tagaattaca tgcaagaagc cgaatgattg ataatgaaga ggaggttact       600
     aataaaatat tagaagcagc aaatgaattg gctggtgaga agtttaattt agatacacct       660
     ataactggct taagtggtgg ccaatccaga gctttaatga tagcagatac tgcaattttg       720
     agtacttcac ccatagtact tattgatgaa atagaaaatg caggaattga tagaaaaaga       780
     gctttaaatc ttcttgtaag caaggaaaaa attgttttga tggcaactca tgatccgagc       840
     ctggctctta tggcagataa aaggattgta attaagaatg gtggtattta taaagtcata       900
     gaaacagata gagaagagaa aagcatatta gaagaattag aaagaatgga tactattatt       960
     agtaaaatga gaacaaacct tagaaatggt gatatattag aaaaagaaaa agtttaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page