(data stored in ACNUC7421 zone)

EMBL: CP002160.PE406

CP002160.PE406       Location/Qualifiers
FT   CDS_pept        532704..533150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0419"
FT                   /product="putative GAF sensor protein"
FT                   /note="SMART: GAF domain protein; KEGG: bpf:BpOF4_03585
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD0"
FT                   /inference="protein motif:SMART:SM00065"
FT                   /protein_id="ADL50197.1"
FT                   /translation="MDKLLVKQMEALITKEDWLITNLSNASALLWSELQDINWAGFYLI
FT                   RDGELVLGPFQGKVACTHIALGKGVCGTAAVEDSTKRIENVHDFPGHIACDSASNSEIV
FT                   IPIHSSKGTVVGVLDIDSPLFGRFSVEDQEILEDIVKIVEKAFD"
     atggataaat tattggttaa gcaaatggaa gcattgatta caaaagaaga ttggcttata        60
     actaatcttt ctaatgcatc tgcattgtta tggagtgagc ttcaagatat taattgggct       120
     ggattttatc ttattagaga tggagaattg gttttaggac cttttcaagg taaagttgca       180
     tgtactcata tagctttagg aaaaggtgta tgtggaactg ctgctgtaga agattctaca       240
     aaacgtatag aaaatgttca cgattttcca ggacatattg cttgtgacag tgcttctaat       300
     tcagaaattg ttattcctat tcacagcagt aagggaaccg ttgtaggagt attagatata       360
     gatagtcctt tatttggacg tttttcagtt gaagatcaag aaattttaga agacatagta       420
     aaaatagttg aaaaagcttt tgattaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page