(data stored in ACNUC7421 zone)

EMBL: CP002160.PE41

CP002160.PE41        Location/Qualifiers
FT   CDS_pept        complement(79966..80868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0043"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase; KEGG:
FT                   cac:CAC0031 phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49832"
FT                   /db_xref="GOA:D9SMP7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP7"
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /protein_id="ADL49832.1"
FT                   /translation="MIKVYNRTTEKYEIEKVAGEKFLNMLYSSPAGKGPLELFIKKKAF
FT                   SRVYGAYNDSFLSKRSIPKFVNSFDIDMDQSVKQLKEFKSFNDFFTRNLVETARPISKN
FT                   NSDFISLGDGRLIAYTNIDMNNLVQVKGLTYSLKDLIKNDTIANKYAGGICLILRLNPT
FT                   DYHRFHFIDSGVCSETTKIKGHYYSVNPIALEKIQRLFCENKREWSIFKSDNFGELLYV
FT                   EVGATCVGSIIQSYKPNKPVARGDEKGYFKFGGSTVILFIEKDKLKLDDDILAQSSLGI
FT                   ETKVSLGETIGCKIQNYNV"
     ttgataaaag tttataatag aaccacagaa aaatatgaaa tagaaaaagt tgcaggcgaa        60
     aagtttctaa atatgctcta ctcttctcca gctggcaaag gtcctttgga actattcatc       120
     aaaaagaaag ctttttctag ggtatatggt gcctataacg atagtttttt gagtaaaaga       180
     tcaataccta agtttgtaaa tagttttgat atagatatgg atcaatcagt aaaacaactt       240
     aaagaattta aaagctttaa tgatttcttt acaaggaact tagttgaaac tgcgagacca       300
     atttcaaaga ataacagtga tttcatatct cttggtgatg gtagacttat agcgtataca       360
     aatatagata tgaataactt agtacaggtt aaaggactta cttattcttt aaaggatttg       420
     ataaaaaatg atactattgc taataaatat gctggaggca tttgtcttat cttaagactt       480
     aaccctactg attatcaccg ctttcatttt attgattctg gtgtttgttc agagactact       540
     aaaataaaag gacactatta ttcagtaaat cctattgctc ttgaaaaaat tcaaagactt       600
     ttttgtgaga ataaaagaga atggagtatt ttcaaaagcg ataactttgg agaattacta       660
     tatgtagaag ttggtgccac ctgcgtaggt tctataatac aaagttataa accaaataag       720
     cctgtcgctc gtggtgatga aaagggttat ttcaaatttg gtggctccac ggttatatta       780
     tttatagaaa aagataagct taaattagat gatgatattt tagcacaatc aagtttaggt       840
     atagaaacca aagtatcttt aggtgagaca atcggttgta aaattcaaaa ttataatgta       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page