(data stored in ACNUC7421 zone)

EMBL: CP002160.PE412

CP002160.PE412       Location/Qualifiers
FT   CDS_pept        537867..538625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0426"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   cth:Cthe_3110 UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50203"
FT                   /db_xref="GOA:D9SQD6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD6"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADL50203.1"
FT                   /translation="MLNQFSRTELLFGKEAMEKLENSKVAVFGIGGVGGFVVEALVRGG
FT                   VGEFELIDDDKVCLTNLNRQIIATRQTVGKYKAEVMKERILSINPKAKVTIHNSFFLPQ
FT                   NSDEFDFKSYSYIVDAIDTVTAKIELVMKSQELGIPIISCMGTGNKLDPTKLEVADIYK
FT                   TTMCPLAKVMRHELKKRRVKRLKVVYSTEKPKRPIEDMAISCRANCICPPGAERKCTDR
FT                   RDIPGSTSFVPSVAGLIIAGEVIKDITGVR"
     atgttaaatc agttttcaag aacagaactt ttatttggaa aagaggcaat ggaaaaatta        60
     gaaaactcca aggtagctgt atttggaatt ggcggtgttg gagggtttgt agtagaagct       120
     ttagtacgag gtggagttgg agaatttgaa ttaatagacg atgataaggt ttgtttaaca       180
     aatttaaacc gacagattat agctactagg caaactgttg gaaaatacaa agcagaagtt       240
     atgaaggaga ggattttatc tattaatcct aaggctaagg taacaataca caatagtttc       300
     tttttgccac aaaattcaga tgaatttgat tttaagtcat atagttatat tgtagatgct       360
     attgatacag ttacagcaaa aatagaactg gttatgaaat ctcaagaact tggtattccg       420
     attattagtt gcatgggtac agggaataaa ctagacccta cgaaattaga ggttgcagat       480
     atatataaaa ccactatgtg tcctttagcg aaagtaatgc gacatgaact aaagaaaaga       540
     agagtaaaac gactaaaggt agtatattct acagaaaaac ctaaaagacc tatagaagat       600
     atggctataa gttgtagagc aaattgtatt tgtccgccag gagcagaaag gaaatgtacg       660
     gatagaagag atatacctgg aagcacatcc tttgttccat ctgttgcagg attaattatc       720
     gctggggaag ttataaaaga tattacaggt gttcgataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page