(data stored in ACNUC7421 zone)

EMBL: CP002160.PE414

CP002160.PE414       Location/Qualifiers
FT   CDS_pept        complement(540381..541256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0428"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: cth:Cthe_2413 NLP/P60"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50205"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD8"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL50205.1"
FT                   /translation="MNKRFFIFQKAINLFKNFIPYNICIINDSVVDVYRSAKTNSERVT
FT                   QTLLCQEVNIEREILGWTKVEVVDGYIGWVKSDKIYKTINNPLPTKVVIKSKMKSIFSA
FT                   MNGTSIIKEITLGTELPVIEKINNWYKVDLTMNRIGWLEDTDTLETASGTHILKTTGID
FT                   FVDTAKKFLGVPYLWGGVSAWGIDCSGLTYICCRVNGVDLPRDAQPQYYSISTSINPNP
FT                   SDMKPGDLLFFSSKPDSKKYLNLISHVGIYIGNNDFIHASGSIGSVTITSLSDEYFTKR
FT                   LVGVKRVFEN"
     ttgaataaac gtttctttat attccagaag gcaataaacc tttttaaaaa tttcataccc        60
     tacaatattt gcattattaa tgactctgtt gttgatgttt atagatctgc aaagactaat       120
     tctgaaagag taactcaaac actcctttgt caagaagtta atatagaaag agaaatctta       180
     ggttggacaa aagtcgaagt agtcgatggg tacattggtt gggttaaatc agataaaata       240
     tataaaacca ttaataatcc tcttcctaca aaagttgtaa taaaatccaa gatgaaaagt       300
     attttttcag caatgaatgg aacttcaata ataaaagaaa taactttagg aacagaacta       360
     cctgttatag aaaaaataaa caactggtat aaagtagatc tcactatgaa taggataggt       420
     tggttagaag atactgatac actagaaaca gcatcgggaa ctcatattct taaaactaca       480
     ggtattgatt ttgtagacac cgcaaaaaaa tttttaggag tcccttatct ttggggtgga       540
     gtgagtgcat ggggtattga ttgttctggt ttaacctata tttgttgccg tgttaatggt       600
     gttgatttgc caagagatgc acaacctcaa tattattcga tttctacctc cataaatcct       660
     aatccctcag atatgaaacc tggcgatctt ttatttttca gttcaaaacc tgattcaaaa       720
     aaatatttaa atctgatttc tcatgttggc atttatatcg gtaacaatga ttttatacac       780
     gcaagcggca gtattggatc ggttactata acctccttat ctgatgaata ttttacaaaa       840
     agacttgtag gagttaaaag agtttttgaa aactaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page