(data stored in ACNUC7421 zone)

EMBL: CP002160.PE415

CP002160.PE415       Location/Qualifiers
FT   CDS_pept        541675..542079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50206"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0297"
FT                   /protein_id="ADL50206.1"
FT                   /translation="MMTKLRSKVFSFILTILAAISFMAVPASALTYSSSSVKSSWTNSS
FT                   YTYYSANIVNNDVQIQGGISYSQAISRIKAGQSVMCYSKSTARNIAYAAGGNKTPVGPE
FT                   IHGSLNNGYYYHYHVYNRATHAHIWYYSQS"
     atgatgacaa agttaagaag taaagtgttt tcatttatat taacaatttt agctgctatt        60
     tcatttatgg cagttccagc tagtgctctt acatattcaa gttcatctgt aaagagtagt       120
     tggacaaata gttcatatac gtattattca gcaaatatag ttaataatga tgttcaaatc       180
     caaggtggca tttcatattc ccaggctata tcaagaatca aggcaggtca gagtgtaatg       240
     tgctatagca aatctactgc acgtaatatt gcatatgctg ctggaggaaa caagacacct       300
     gttggacctg aaattcacgg ttcactgaat aatggttatt attaccatta ccatgtttac       360
     aacagagcta ctcatgcaca tatttggtat tattcacaaa gctaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page