(data stored in ACNUC7421 zone)

EMBL: CP002160.PE418

CP002160.PE418       Location/Qualifiers
FT   CDS_pept        complement(543848..544753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0432"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: tit:Thit_2065 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50209"
FT                   /db_xref="GOA:D9SQE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50209.1"
FT                   /translation="MVIETENLSKIYKNNKGCKDISIAVPQGEIYGFLGPNGAGKSTFI
FT                   KTIVGLLFPTSGTANILGKPIGDIEAKRKIGYLPELFKYQEWMTGLDLLSFHASLYKLD
FT                   KKTSTKKIDEVLEIVNLKGAEKNKIGTYSKGMQQRIGIASALLCDPELLFLDEPTSALD
FT                   PIGRKEVRDIMIELKNRGKTVFLNSHLLSEVEMVCDSAAIISKGTIIKQGKMNELLEGD
FT                   TVLDIHAEDITNEILNKLEKIDEDVVFDGKNIKMHINQNRQIHDIASLIIAGGGKLYGL
FT                   TPHRNSLEELFIKLVERGQE"
     ttggtgattg agacagaaaa cctttctaaa atatataaga ataataaagg ttgtaaagat        60
     ataagtatag ctgttcctca aggcgaaatt tatggatttt taggtccaaa tggtgctggt       120
     aaaagtacct ttataaaaac tattgtagga ttactatttc ctacctcagg gactgcaaat       180
     atactaggta aacccattgg tgacattgaa gcaaagagaa aaataggtta cttacctgaa       240
     ctttttaaat atcaagaatg gatgacagga ctagacctcc tgtccttcca cgcttcacta       300
     tataagctag ataaaaagac ttcaacaaaa aaaatagatg aagtccttga aatcgtcaat       360
     ctaaaagggg ctgaaaagaa taaaatcgga acctacagta aaggaatgca acagcgaata       420
     ggcattgcca gtgctctcct ttgcgatcca gaacttctat ttttagatga accaacttct       480
     gctctagacc ctattggcag aaaagaagtt agagatatta tgattgaatt aaaaaacaga       540
     ggaaaaactg tatttttaaa tagtcatctt ctaagtgaag tagagatggt atgtgatagt       600
     gcagcaatta tcagtaaagg aaccatcata aagcaaggta aaatgaatga gctcttagaa       660
     ggagacacgg ttttagacat tcatgctgaa gatataacta atgaaatttt aaataagctt       720
     gaaaaaattg atgaagatgt agttttcgat gggaaaaata taaaaatgca tataaaccag       780
     aaccgacaaa tacatgacat tgcatcatta attatagctg gtggtggaaa actctatggt       840
     cttacacctc atagaaatag cttggaagag ttatttatta agcttgttga aagggggcaa       900
     gaataa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page