(data stored in ACNUC7421 zone)

EMBL: CP002160.PE42

CP002160.PE42        Location/Qualifiers
FT   CDS_pept        81432..81653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0044"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: cac:CAC0669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49833"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP8"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ADL49833.1"
FT                   /translation="MDQNIKPEILDKLTKICLCKSISRATIKAAIIKGAKTIEEVNKAT
FT                   GAGTGGCQGRRCGPKIQELLEAHENGEF"
     atggatcaaa atattaaacc agaaatacta gataaactca caaagatatg cttatgtaaa        60
     agtatatcca gagcaactat aaaagcagct ataataaaag gtgcaaagac tatcgaggaa       120
     gtaaacaaag ctacaggtgc tggtactggg ggatgtcaag gaagacgttg tggtcctaag       180
     attcaagaac ttcttgaggc acatgaaaac ggagagtttt ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page