(data stored in ACNUC7421 zone)

EMBL: CP002160.PE422

CP002160.PE422       Location/Qualifiers
FT   CDS_pept        547857..548507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0436"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: msi:Msm_0806 polar amino acid ABC transporter,
FT                   permease component; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50213"
FT                   /db_xref="GOA:D9SQE6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE6"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADL50213.1"
FT                   /translation="MSLSIMLSQLGKGFIYTIEIFALTLLFALPLGLLISFGRMSKNFL
FT                   VRAVTKFYISVMRGTPLMLQLIVVYFAPYYVFKIQLGNSYRFIAVIIAFVLNYAAYFAE
FT                   IYRSGIESIPVGQYEAAKVLGYTKSQTFFKIILPQVIKRILPPVTNETITLVKDTSLAF
FT                   VLSIVEMFTAAKQVAASGTTMMPLMVAGLFYYIFNLLVAIAMEQVEKKLSYYR"
     atgagtttgt caattatgtt atcacaatta ggaaagggat ttatttatac tattgagatt        60
     tttgcactta ccttactgtt tgcattgcca cttggattac ttatatcttt tggtagaatg       120
     tcaaaaaact ttttggtacg tgcagtaact aaattttata tctcagtgat gcgtggtacg       180
     ccactaatgc tacaattaat tgtagtttat tttgcaccat attatgtgtt taaaatccag       240
     cttggaaatt catatcgttt tatagcggtt attattgcat ttgtattaaa ttatgcagcg       300
     tactttgctg agatatatcg ttcaggaatt gaatctatac cagtaggaca atatgaagct       360
     gcgaaggtat taggttatac gaaaagccaa actttcttta aaattatatt gccacaggtc       420
     attaaacgta ttttaccacc agtaactaat gaaacaatta ccttggtaaa agacacctct       480
     ttagcttttg tattatctat tgtagaaatg ttcactgcgg caaaacaagt tgcagcttca       540
     gggacaacaa tgatgccatt aatggttgca ggcttgttct attatatatt taatttatta       600
     gttgctatag caatggaaca agttgaaaag aaactaagct attacagata a                651
//

If you have problems or comments...

PBIL Back to PBIL home page