(data stored in ACNUC7421 zone)

EMBL: CP002160.PE425

CP002160.PE425       Location/Qualifiers
FT   CDS_pept        550611..552317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0439"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; thiamine pyrophosphate central
FT                   domain-containing protein; KEGG: npu:Npun_R2059 thiamine
FT                   pyrophosphate binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50216"
FT                   /db_xref="GOA:D9SQE9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE9"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADL50216.1"
FT                   /translation="MNVKTGKEAIIEQFLADGITHMFGNPGTVEQGFLDALEKYPDFHY
FT                   ILTLQESIAVAMADGYARKTKKPTVVQLHSGVGLGNGIGMIYQAKRGHAPLVVINGESG
FT                   IKYEAMDAQMAADVVAMAEPVTKWSTKVVDPESLLRVLRRAIKIATTPPMGPVFVCLPM
FT                   DILDAPIQDEIVPTSILNTRSYPEEKTLESAAEILASAKYPMIIMGDGITFSGAQEELV
FT                   KVAELIGAEVWGADSSEVNISASHPQFRGLLGHMFGEQSKKDVEEADAVLIVGTYIFPE
FT                   VFPLLKGIFANGAKLIHVDLDSYEIAKNFPVDIGIVSDPKSTLSKLAEVLDKTMAPDQR
FT                   LIAALNISRMVKEKAKTIEEMNSKDEKLMNSFPIYPPKFMQELARQLPKDAIIFDEALT
FT                   SSPDLNRYIPATVPGQFFQTRGGSLGVGIPGAMGIKLAAKDKTVIAFTGDGGSMYTIQA
FT                   LWTAVHHNIDAKFIICNNKSYRLLMQNIDQYWKERDIPKHEYPKSFILDNPDIRFDQLS
FT                   ESMGVSALRIEKPEEIADAVQRMLSTKGPFLIDLVIENNQYTSESVCKCGQ"
     atgaatgtta aaacaggaaa agaagctata attgagcaat tccttgcaga tgggattact        60
     catatgtttg gtaatccagg aactgttgag caaggatttt tagatgcttt agagaaatac       120
     ccagatttcc attatatact gacactacaa gaatctattg cagttgcaat ggctgatgga       180
     tatgctagaa agacaaaaaa gcctacagtc gtacaattgc attccggcgt aggcttagga       240
     aatggaatag gaatgatata tcaagcaaaa agaggtcatg ctcctttagt ggttatcaat       300
     ggtgagtctg ggataaaata cgaagccatg gatgctcaaa tggcagcaga tgtagttgct       360
     atggcagagc ctgttacaaa gtggtcaaca aaagttgttg atcccgaatc tcttttgaga       420
     gtgttgagaa gagcaataaa aatcgctaca acgcctccaa tgggaccagt tttcgtgtgc       480
     cttcctatgg atattttaga tgcacctatt caggatgaaa tagtacctac atctatatta       540
     aatactcgtt cttatccaga agaaaaaacc ttagaatcag cggcagaaat tctagcaagt       600
     gctaagtacc ctatgataat aatgggagat ggtattactt tctctggggc acaagaagag       660
     ttagtaaaag ttgcagagct tataggtgca gaggtttggg gcgcagattc ttcagaagta       720
     aatatttctg cttcacatcc acaatttaga ggacttttag gacatatgtt tggagaacaa       780
     tcaaagaaag atgtagaaga ggcagatgca gttcttattg taggaacata tattttccca       840
     gaagttttcc ctctactaaa aggtattttt gcaaacggag ctaagcttat tcatgttgat       900
     ctagattctt atgagatagc taagaatttt ccagtagata taggtattgt aagtgatcct       960
     aaaagtactc tttctaagtt agctgaggta ttagataaaa ctatggcgcc agatcaacgg      1020
     cttatagcag ctttaaatat tagtaggatg gttaaggaaa aagcgaaaac tatagaggaa      1080
     atgaattcaa aggatgaaaa gttaatgaat tcatttccta tataccctcc aaaatttatg      1140
     caggaacttg caagacaact tccaaaagac gcaataatat ttgatgaagc attaacttct      1200
     tctccagatc ttaatagata tattcctgca accgtgccag gtcagttttt tcagacaaga      1260
     ggtggctcat tgggagtcgg tataccagga gctatgggaa taaaattagc ggctaaggat      1320
     aaaacagtta ttgcttttac tggtgatggt ggaagtatgt atacaatcca agctttgtgg      1380
     actgcagtac atcataatat agatgcaaag tttattattt gtaataataa aagctataga      1440
     ttattgatgc aaaacattga tcaatattgg aaagaacgag atatacctaa gcatgagtat      1500
     ccaaagtcat ttattttaga taacccagat attcgatttg atcaattgtc agagtctatg      1560
     ggagtgtctg cattaagaat tgaaaagcca gaagaaattg cagatgctgt acaaagaatg      1620
     ctcagtacaa aaggcccatt tcttattgat cttgtaattg aaaataatca atatacaagt      1680
     gaaagtgttt gtaagtgtgg gcagtaa                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page