(data stored in ACNUC7421 zone)

EMBL: CP002160.PE426

CP002160.PE426       Location/Qualifiers
FT   CDS_pept        552340..552768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_2188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50217"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF0"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_2188"
FT                   /protein_id="ADL50217.1"
FT                   /translation="MLTRYEVNELVFKWFRKLDIHDTVEGFLPLLVAEGLEMNLPEGTF
FT                   KGIEGFTEWHHNIVNKFFDHTHTLAIVDIEIEEEKAKVKVVVNWQTKIWNPPDVKSTWL
FT                   GFDAYQTWIVEKDSKTGKAVIAKYTVDNLEPMLGSASL"
     atgcttacaa ggtatgaagt aaatgaatta gtatttaagt ggtttagaaa acttgatata        60
     catgacactg ttgaagggtt tttaccatta ttagtagcag aaggccttga aatgaattta       120
     ccagagggaa cctttaaagg gattgaaggc tttacagaat ggcatcacaa catagtaaac       180
     aaattctttg atcacacaca tactttagct atagttgata tagaaattga agaagaaaaa       240
     gcaaaagtga aggttgttgt aaattggcaa actaaaatat ggaatccacc tgatgtaaag       300
     agcacatggc taggctttga cgcttatcag acttggattg ttgaaaaaga tagtaaaaca       360
     ggaaaggcag ttattgcaaa gtatactgtt gataaccttg aacctatgct tggttcagct       420
     tcgttatga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page