(data stored in ACNUC7421 zone)

EMBL: CP002160.PE429

CP002160.PE429       Location/Qualifiers
FT   CDS_pept        554086..554907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0443"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   syd:Syncc9605_0829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50220"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF3"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADL50220.1"
FT                   /translation="MEASNMKVINKAGITIHISSSPLDGEKVNSIIVESQNKLVVIDVP
FT                   LLRPYSKDFRAYANQLGKPIDRVIITHAHPDHWAGLEAFEDLPIYSLSETQEEIQENGE
FT                   WMLTYHRSLHGDLITDKKIVPNNIIEEGKLIIDSVEYNAIKVTEAEYKHLLVLELPRIK
FT                   TLISQDMVYNKVYLFLGELTSTGELACDNWIDELKKYKEKNYEVVIPGHGEPTDSSIID
FT                   ENINYIIEAKGIIKTSKDSDEFKNRMIEKFPDYEIPLMLDMTAYFIYMQNK"
     atggaagcat ctaatatgaa agttattaat aaagctggaa ttacaattca catatcttca        60
     agtcctcttg atggtgaaaa agtaaattct ataatagtgg aatcacaaaa taaattagtt       120
     gtaattgatg tacctttatt gagaccatat tcaaaagact ttagagctta tgcaaatcag       180
     ttaggaaagc ctatagacag agtaattatt acccatgcac atccagatca ttgggcaggc       240
     cttgaagctt ttgaagactt accaatatat tcgctttcag aaactcaaga agaaatacag       300
     gaaaatggcg aatggatgtt aacttaccat aggtccctac atggtgatct tatcactgat       360
     aaaaagattg ttccaaataa cattatcgaa gaaggcaaat tgataataga cagtgttgaa       420
     tataatgcaa taaaagttac agaggcagaa tataagcatc tacttgtact agagcttcct       480
     agaattaaga cattgatatc acaagatatg gtatacaata aggtttattt attccttgga       540
     gagttaactt caacaggaga attagcttgt gacaattgga ttgatgaact taaaaagtat       600
     aaggaaaaga attatgaagt tgtaattcct ggacatgggg aaccaacaga ttcatctata       660
     attgatgaga atatcaatta cattatagaa gcaaagggta ttattaagac ttcaaaggat       720
     tctgatgaat ttaagaatag gatgattgaa aaattcccag actacgaaat tcctttaatg       780
     ctagacatga cagcatattt tatttatatg caaaataaat aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page