(data stored in ACNUC7421 zone)

EMBL: CP002160.PE43

CP002160.PE43        Location/Qualifiers
FT   CDS_pept        81936..82379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0045"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   cac:CAC0123 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49834"
FT                   /db_xref="GOA:D9SMP9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP9"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADL49834.1"
FT                   /translation="MNNNFLKIAIEEAKKARELGEVPVGAVIIKDDKVIAAAHNLKETK
FT                   KEVTAHAELLAIKMASEILDNWRLNDCEIYVTLEPCAMCASAIVQSRIKKIYIGTFEPT
FT                   TGACGSVINLVQNEALNSFVHVEWLYSDECSDIITEFFKERRS"
     atgaataaca attttttaaa gatagcaata gaagaagcta aaaaggctcg agaacttggt        60
     gaggttccag taggtgctgt cataataaaa gatgataagg ttatagcagc agctcataat       120
     ttaaaggaaa ctaaaaaaga ggttacggca catgctgagt tattagctat aaaaatggcg       180
     tctgaaattc ttgataattg gaggcttaat gattgtgaaa tatatgtgac actagagcca       240
     tgtgctatgt gtgcttcagc tattgttcaa agtagaatta aaaagatata tataggaact       300
     tttgaaccaa caacaggagc atgtggttct gtaataaacc tagtccaaaa tgaagcactc       360
     aatagttttg ttcatgtaga atggctttat agtgatgaat gtagtgatat aataacagaa       420
     ttttttaagg aaagaagaag ctag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page