(data stored in ACNUC7421 zone)

EMBL: CP002160.PE434

CP002160.PE434       Location/Qualifiers
FT   CDS_pept        560035..560424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eat:EAT1b_0970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50225"
FT                   /db_xref="GOA:D9SQF8"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF8"
FT                   /inference="similar to AA sequence:KEGG:EAT1b_0970"
FT                   /protein_id="ADL50225.1"
FT                   /translation="MKKILKDFLFGLLLMFNITICKFLVTLPFEMPMDFTNENYSYVIN
FT                   REFLVTSLPALVITLIYTRLLKTKTKADALRKSIIWTIVVILNYSLIGIGNDNFKIIFG
FT                   GWGIYSLIASVFIAPILSLYIRKHN"
     atgaaaaaaa tattaaaaga ctttttattt ggattattgc ttatgttcaa tataactatt        60
     tgtaagttct tagttacatt gccttttgaa atgcccatgg attttactaa tgaaaattat       120
     tcatacgtaa taaacagaga atttttagta acttcattgc ctgcattagt tattacgctt       180
     atatatacaa ggcttttaaa aacaaaaact aaggcagacg cgttaagaaa aagtattata       240
     tggacaatag ttgttatttt aaactattct ctaattggga taggaaatga taattttaag       300
     ataatctttg gtggttgggg gatttatagt ttgattgcaa gtgtattcat agcaccgatt       360
     ttatcattgt atattagaaa acataattaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page