(data stored in ACNUC7421 zone)

EMBL: CP002160.PE437

CP002160.PE437       Location/Qualifiers
FT   CDS_pept        complement(564593..565087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0452"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: clo:HMPREF0868_0081
FT                   hydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50228"
FT                   /db_xref="GOA:D9SQG1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL50228.1"
FT                   /translation="MNETGLLAGRTKMDWYAEMAGMICTVRAAALIIKDNNFLAAKSPD
FT                   YDCYYTVGGGVQINETSEEAIIREIYEETGYRLEIDKLAFVQERFYEVDKHRYHEIVFF
FT                   YLMIDSDDVNISDSSFTDLPKETLHWLPLDDLNKINLVPEFLKNKSFNNISNVEHIISK
FT                   E"
     atgaatgaaa cagggttact tgccggcaga acaaaaatgg attggtatgc agaaatggca        60
     gggatgatat gtaccgtaag agcagctgct ctgattatca aagataataa ttttcttgca       120
     gcaaaaagtc cagactatga ttgctattac acagttggcg gaggtgttca aattaatgaa       180
     acctcggaag aagccattat tcgagaaatt tatgaggaaa caggctacag gcttgaaata       240
     gataaacttg cgtttgttca agaacggttt tatgaagtag ataagcaccg ttatcatgaa       300
     atagttttct tttacttgat gatagatagt gatgatgtga acatttcaga tagcagtttc       360
     acagatttgc caaaagaaac tttgcactgg ttgcctttag atgatttaaa taaaatcaac       420
     ttagttccag aatttcttaa gaacaagtca tttaacaata tatccaatgt agaacatatc       480
     atctcaaagg aatag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page