(data stored in ACNUC7421 zone)

EMBL: CP002160.PE439

CP002160.PE439       Location/Qualifiers
FT   CDS_pept        566417..567814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0454"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: mhu:Mhun_2065 FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50230"
FT                   /db_xref="GOA:D9SQG3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG3"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADL50230.1"
FT                   /translation="MKKIIIIGAGISGLSAGCYGQMKGYETEIFELQGTVGGLCTTWNR
FT                   KGYLIDGCIDWLIGINPDNYLYDSWKELGVFEGDGFIQHDYSMQVEDGLGKKLILYSDI
FT                   NKLEEHLLQLSPIDEPLIKELSEAIRISAFSSKTVKPVFNKKFATMSLYDFLQQFKDRF
FT                   LREALGVTLIPLQPKEYPVGTFIFRHSFYNRKDASWSIGGSLAFAQRIENKYKALGGKI
FT                   NYRVEVQEVIVKDNKAVGVRLADGSEHYADYVISTIDGYKTVFDLLKGKYLNDEIKQLF
FT                   NEEKDLPSSMQISLGIHCDLSEEPHNIVLKLKEPFVVGDKINSYLYLKQFSFDKLMCKP
FT                   GKSVITSIIETDYEYWDDLHKDIYKYNLEKERLCEIFIKIIEERFPQVKGKIEVTDVAT
FT                   PVTYNRYTGVWKGSYLGWWNMSATTLPAVLPGLENFYIAGQWAEALGGLPISMMTGKGV
FT                   ITKISEI"
     ttgaagaaga taattataat tggagcagga attagtgggc tttctgctgg atgttatggt        60
     caaatgaagg gatatgagac agaaatattc gagcttcagg gtacagtagg tggtttgtgt       120
     actacttgga ataggaaagg ttatttgata gatggatgta tagattggtt aattggaata       180
     aatccagaca attatttgta tgattcttgg aaggaacttg gtgtcttcga gggtgatggt       240
     tttatccaac atgattattc tatgcaggta gaagatggat tggggaaaaa gcttatttta       300
     tatagtgata taaacaagct agaagaacat ttgcttcagt tgtcgcctat agatgagccg       360
     ttaattaaag aattgtcaga agctataaga atatcagcat tttctagtaa aactgtaaag       420
     cctgtgttta ataaaaaatt tgctactatg tctttatatg attttcttca gcagtttaag       480
     gatagatttt taagagaagc cttaggggtc actttaattc ctttacaacc aaaggaatac       540
     ccagttggaa catttatttt taggcattct ttttataacc gaaaggatgc tagttggtct       600
     attggtggtt ctcttgcctt tgcacaaaga attgaaaata agtacaaggc attaggtgga       660
     aaaataaatt atagagtaga agtacaggaa gttatagtta aagataataa agctgtaggc       720
     gtaagattag ctgatggttc tgaacattat gctgactatg tcatttcaac aatagatggt       780
     tataaaactg tttttgattt gctcaagggt aagtatttaa atgatgaaat taagcagctt       840
     ttcaacgagg aaaaagattt acctagttca atgcaaatat ctttgggaat ccattgcgat       900
     ttatcggaag aacctcataa catagtattg aaattaaagg agccctttgt ggttggcgac       960
     aaaattaatt cttatctata tttaaagcaa ttttcttttg ataagttaat gtgtaaaccg      1020
     gggaaatctg tgataacttc aattattgaa actgattatg aatattggga cgaccttcat      1080
     aaggatattt ataagtataa cttagaaaag gaaaggcttt gcgaaatatt tataaaaata      1140
     attgaagaaa gatttccaca ggtgaaagga aaaatcgaag ttactgatgt tgctacgcca      1200
     gtaacttata atagatatac tggagtttgg aaaggttcgt atttgggatg gtggaacatg      1260
     tctgctacta ctcttccagc tgttttacca ggtcttgaaa atttctatat tgctggacaa      1320
     tgggcagaag ctttaggcgg gcttccaatc agtatgatga caggaaaagg agttatcaca      1380
     aaaataagcg aaatttaa                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page