(data stored in ACNUC7421 zone)

EMBL: CP002160.PE442

CP002160.PE442       Location/Qualifiers
FT   CDS_pept        569954..570748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0457"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   cpf:CPF_0173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50233"
FT                   /db_xref="GOA:D9SQG6"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG6"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADL50233.1"
FT                   /translation="MLRRYSRLYIKFVSQYFKSLMEYKIDFLVGCLGFFVAQASGIVFI
FT                   YLVFQNIPDLNGWDFYQIVFIYAFAQLPRGIDHLFTDNLWILGGWVILRGELDKYLLRP
FT                   INPLFHFLAEKFQLEALGELVIGIILMVIAGNKLNLHLNALDIILFIILVFAGALIYTA
FT                   IKLFAASLSFWIKNSQSLLNFIYNVSDFAKYPLSIYSLSIKIILILIVSFAFTAYFPAA
FT                   YFVNKESFVTGVLGTVAASIISFTIAYFTWIKGMKNYEGAGN"
     atgttaagaa gatactcacg attatatata aaatttgttt cacagtattt taagtcccta        60
     atggaatata aaattgattt tcttgtaggg tgcttgggtt tcttcgtagc ccaagcttct       120
     gggatagttt ttatttattt ggtttttcaa aacattccag atttaaatgg ttgggacttc       180
     taccagattg tttttatcta tgcttttgca cagctaccaa gaggaataga tcatctattc       240
     actgataatc tttggatttt aggtggatgg gtaatactta gaggggagct tgacaagtat       300
     cttttaagac caataaaccc attatttcat ttcttagctg agaagtttca gctagaagct       360
     ttgggggaat tggttattgg tataattctt atggttatag caggtaataa actaaactta       420
     catttgaatg ctttagatat tattctattt ataatacttg ttttcgcagg agctttaatt       480
     tatacagcta ttaagctttt tgccgcttcg ttatcttttt ggataaagaa tagccagtcc       540
     ttacttaact ttatctataa tgtaagtgat tttgcaaaat atcctttaag tatatattca       600
     ctatcaatta aaattatttt aatattgata gtatcttttg catttactgc atattttcca       660
     gcagcgtatt ttgtaaacaa agaaagcttt gtcacagggg ttttaggaac agtagctgca       720
     tcaataattt cttttacaat tgcatatttc acttggataa agggtatgaa aaactatgaa       780
     ggtgctggca actag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page