(data stored in ACNUC7421 zone)

EMBL: CP002160.PE445

CP002160.PE445       Location/Qualifiers
FT   CDS_pept        573138..574196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0460"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: cbe:Cbei_3073
FT                   D-galactose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50236"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQG9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADL50236.1"
FT                   /translation="MKILRMLFILIVSLLLIIMQTSNAKNNIFASENIKIANVAVVMND
FT                   FQHPQMLFIKQGLTDIQNENRDKVNFIFYDGKGNLAIQTEIINSLISNSNIDLMVIGLI
FT                   NPQSDVVEDIIRKADLRNMPIIMNDVNPETALKLSKGYSKVIFLKGKSEEVGILQGKIL
FT                   VDEWNNKGMDKNKDNILQYVMLKGETNNPVANVREKYSVSTINEAGIKTQQLALRVVNW
FT                   NKEIAKQAIEALLLKYDGNIEAIIANDDTIAIGAIEALQKYGYNKGNKSKYIDVVGATG
FT                   LQEVKDLIDKGFMTGTAIINYEAQAEAVYKIAMNLLNNESPIKDTNYTISDGFVVLTVD
FT                   YFPYTKKNNISS"
     atgaaaatat taagaatgct atttatatta attgtaagtt tattattgat tattatgcaa        60
     acaagtaatg ctaaaaataa tatatttgct agtgaaaata taaaaatagc caatgttgca       120
     gtagtaatga atgattttca acatccacaa atgttgttta ttaaacaagg gcttacagat       180
     atccaaaacg agaatcgaga taaagtgaac tttattttct atgatggtaa aggaaattta       240
     gctatacaaa cggaaataat aaattcgttg atttcaaatt ccaatattga tcttatggta       300
     attggactaa ttaatccaca aagtgatgta gtagaagata ttattcgtaa agctgattta       360
     cgaaacatgc caataatcat gaatgatgtt aatcctgaaa cagcattaaa gctttctaag       420
     ggttatagta aagttatatt tcttaaagga aaatcagaag aagtggggat tcttcagggg       480
     aaaattcttg ttgatgaatg gaataataaa ggtatggata aaaataagga taacatattg       540
     caatatgtta tgttaaaagg agaaactaac aatccagttg caaacgttag agaaaagtat       600
     tctgtttcaa caattaatga agcaggaata aaaacacaac agcttgcact aagagttgtt       660
     aattggaata aagaaatagc taaacaggct attgaagcat tattgcttaa atatgatggt       720
     aatattgagg caataattgc aaatgatgat actatagcaa taggggctat tgaagctttg       780
     caaaagtatg gttacaataa aggaaataaa tcaaaatata ttgatgttgt tggagctact       840
     ggattacaag aagtcaaaga tttaattgat aaaggattta tgactggtac tgctattatt       900
     aattacgagg ctcaagctga agcagtttat aaaattgcaa tgaacttact taacaatgag       960
     agtcctataa aagatacaaa ttatacaatt agtgatgggt ttgttgtact tacagtagat      1020
     tattttccat acacaaagaa aaataatatt tcatcatga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page