(data stored in ACNUC7421 zone)

EMBL: CP002160.PE447

CP002160.PE447       Location/Qualifiers
FT   CDS_pept        complement(575843..576127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0462"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   ere:EUBREC_2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50238"
FT                   /db_xref="GOA:D9SM09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SM09"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADL50238.1"
FT                   /translation="MAKHLDKQFKIDAIQYYQDHKELGLVGCAKNLGISQQTLSRWQKE
FT                   LRETGDIESRGSGNYSSDEAKEIARLKRELRDTQDALDVLKKAISILGK"
     atggcaaaac atttagacaa acagtttaag attgatgcaa ttcaatatta tcaagatcac        60
     aaagaattag gactagtggg gtgtgctaag aatcttggca ttagtcagca aactctttcc       120
     agatggcaga aagaactgcg agaaactggc gatatagaaa gtcgtggatc tggcaattat       180
     tcttccgatg aggcaaaaga aattgctcgt ttaaaacgtg aattacgtga tactcaggat       240
     gctcttgatg tattaaaaaa agccatcagc attctgggaa aataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page